HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0641COG0101KOG2554 KOG2553arCOG04449Pseudouridylate synthasepseudouridylate synthase I

HOG Organism Gene ID Name Annotation
cHOG0641 nrc1 VNG2003 truA pseudouridylate synthase I
cHOG0641 hmu HMUK1305 Hmuk_1305 tRNA pseudouridine synthase( EC:5.4.99.12 )
cHOG0641 hma RRNAC3188 truA tRNA pseudouridine synthase A
cHOG0641 hwa HQ1108A truA tRNA pseudouridine synthase A
cHOG0641 hla HLAC1665 Hlac_1665 tRNA pseudouridine synthase
cHOG0641 hbo HBOR04540 Hbor_04540 pseudouridylate synthase I( EC:5.4.99.12 )
cHOG0641 hut HUTA2002 Huta_2002 tRNA pseudouridine synthase
cHOG0641 hvo HVO_1852 HVO_1852 tRNA pseudouridine synthase A
cHOG0641 nph NP5042A truA tRNA pseudouridine synthase A
cHOG0641 hhi 451 truA tRNA pseudouridine synthase A
MUSCLE (3.6) multiple sequence alignment


1108|gene|hwa       ---MSAQMRAFRLAYDGRPFSGFQRQPSVPTVEDALFDALDSLDV-FNRDTDS----KPS
4540|gene|hbo       -------MRAFRIAYDGRPFYGFQRQPSVPTVEDSIFDALRSLGV-LDED-AR----KPT
2002|gene|hut       --MTDVSRRAFRIAYDGRPFHGFQRQPDVATVSDAILDALRELDV-LEDG-DN----VPP
1665|gene|hla       MTDASAATRAFRVAYDGREYAGFQRQPHATTVEGTLLRALAKHGI-LDRG-DGPTHATPP
5042|gene|nph       -------MRAFRIAYDGTGFRGFQRQPHGETVENALFEALSSLGVAFEDG-------RPP
2003|gene|nrc1      -----MPRRAFRVAYDGRPYHGFQRQPDVSTVAGELFGALRRLDV-FDGA-------KPP
13188|gene|hma      -------MRAYRVAYDGQPYHGFQRQPDVDTVEGRLRSALVRLGV-CERG-EG----LPD
451|gene|hhi        -------MRAYRVAYDGRPYHGFQRQPDVDTVEGRLRSALVRLGV-CERG-DG----LPE
                            **:*:****  : ******   ** . :  **   .:  :          * 

1108|gene|hwa       GYAAAGRTDAGVSALRQTVGFECPSWCTPRALNSELPTSVRAWASADVQSGFHATHDALQ
4540|gene|hbo       GYAAAGRTDAGVSALAQTVAFDCPEWCTPRAMNAELPESVRAWAAADVGERFHATHDAAR
2002|gene|hut       GYAAAGRTDAGVSALAQTVAFDCPDWLSPAALNSELPADVRAWASADVPAEFHATHDAVA
1665|gene|hla       GYAAAGRTDAGVSAVAQTVAFEAPDWLTPRAFNGHLPGSVRVWAAADVPAGFHATHDAVR
5042|gene|nph       GYAAAGRTDAGVSARAQTVAFEAPAWLLPRALNGELPASVRAWAAADVGDAFHATHDATA
2003|gene|nrc1      GYAAAGRTDAGVSARAQTVAFDAPAWLTPDAFTGALPDPIQVWAHADAPPEFHATHDAVA
13188|gene|hma      RYAAAGRTDAGVSARTQTVAFDAPAWLSPAAFNGELPNDVRVWASADVPEDFHATHDAAE
451|gene|hhi        CYAAAGRTDAGVSARAQTVAFDAPAWLSPAAFNGELPDDIRVWASVDVSEGFHATHDATE
                     *************  ***.*:.* *  * *:.. **  :..** .*.   *******  

1108|gene|hwa       RTYTYYLYGPE----------LDMNRLNTAAEILSGKHDFHNFTSDDDGTTRKLSITLEF
4540|gene|hbo       RAYVYDLYAPE----------ADESKAQAAADALTGEHDFHNLTPDDTGTVRDVTVSVEA
2002|gene|hut       REYTYHLHAPD----------ASVSRAGDALDALAGEHDFHNFTPDDTGTVRDLTGEARS
1665|gene|hla       RTYRYHLYAPARVEETDHDHAVDDGRVRDALARLSGEQDFHNLTSDETGTVRDLTTTATR
5042|gene|nph       RAYRYFLYAPE--------PSADTTRARAACARLSGSHDFHNFTPDDRGTERTLSMRLRR
2003|gene|nrc1      RTYVYYWYAPD--------SRATDDRAAGALDRLTGTHDFHNLTPNTTNTVRELDATLDR
13188|gene|hma      RTYTYYLYAPADADRPEHEP-VDDGRWADAVDALAGTHDFHNLTTDETGTERTVAIDWTR
451|gene|hhi        RTYTYYLYAPTDADRLGREP-VNDERWGEAVDALAGSHDFHNLTSDDTGTERTVDIDWTR
                    * * *  :.*               .   *   *:* :****:*.:  .* * :      

1108|gene|hwa       DDPFITARITADGFPRSLIRRLMSALRGVGSESMTIETLTGLLNTVPQTGPDGIPTASPE
4540|gene|hbo       DGEFLVLSVAAGGFPYNLVRRLASIVHSVATGDRPLADIETVLGPETVPGPEGVPTAPAE
2002|gene|hut       EGDFLVVTLRADGFPRQFVRRAVTVIDALASGVAELDRIEQLLGDDPVEGPAGVAPAAPE
1665|gene|hla       EGDILVVEVSAGGFPRALVRRLVAAVRAVGRGTADPSLIDRLLASEPISGEFGIGPAPPE
5042|gene|nph       QGPFLVVDCRAGGFARQLVRRLVAAVAAVARGERPLSFLGRALDDDPLSGADGIAAAPPE
2003|gene|nrc1      DGAFRVITVRAGGFCRELVRRVVSLVQLVTE-TGDTDRIDTVLGDEPVAGPDGVPPADPH
13188|gene|hma      DGQFLVVQLTAGGFCRQLVRRLVSLAAAVADGSAPLSKVDRILSPEPVSGPDGVPPAPPE
451|gene|hhi        DGQFLVVRLTAGGFCRQLVRRLVSLAAAVADGSAQLSKVDRILSPESASGPDGVPPAPPE
                    :. : .    *.**   ::**  :    :         :   *   .  *  *: .* . 

1108|gene|hwa       PLILTRVTYPDATFRIDNRAINSLKSVFTHRYQRCLTQARVAEHI-VSKSGSDQN
4540|gene|hbo       PLVLERVVYPGVTFERDPEAVESAAGVFEKRRRDGLIRTRVAGRIRRGIEGDSER
2002|gene|hut       ALVLTAVEYPGLSFERDESALASARAIFETKAIDHRTNARVASRIADGI--DQEE
1665|gene|hla       PLVLWDVSYEGVAFEVDPEAAESARVAFGERYRDARHAAAATGAIRDRIAGTDQS
5042|gene|nph       PLLLADVVYPGVEFTVDDRAAESARTVFATRRRQRLADARVAGALSPPE------
2003|gene|nrc1      PLVLHAVAYDGLSFTVDEDAAERARTTFRAARADHHERARVAGHLASI-------
13188|gene|hma      PLVLTDVRYPNVSFTRDEDAAVDARTVFARRRATARTTARVADHITDGL------
451|gene|hhi        PLVLTDVRYPNVTFSRDEDAAADARAVFEHRRTEARTTARVADHITDGL------
                    .*:*  * * .  *  *  *       *          : .:  :