HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0640COG0494KOG4313 KOG2839 KOG2937 KOG3041 KOG3069arCOG01078NTP pyrophosphohydrolases including oxidative damage repair enzymesdiadenosine tetraphosphate pyrophosphohydrolase

HOG Organism Gene ID Name Annotation
cHOG0640 nrc1 VNG0431 apa diadenosine tetraphosphate pyrophosphohydrolase
cHOG0640 hmu HMUK3070 Hmuk_3070 NUDIX hydrolase
cHOG0640 hma RRNAC0661 apa diadenosine tetraphosphate pyrophosphohydrolase
cHOG0640 hwa HQ2391A apa bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (diadenosine tetraphosphatase)
cHOG0640 hla HLAC1402 Hlac_1402 NUDIX hydrolase
cHOG0640 hbo HBOR18440 Hbor_18440 NTP pyrophosphohydrolase
cHOG0640 hut HUTA0878 Huta_0878 NUDIX hydrolase
cHOG0640 hvo HVO_1391 HVO_1391 apa diadenosine tetraphosphate pyrophosphohydrolase
cHOG0640 nph NP4092A apa bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
cHOG0640 hhi 1315 apa diadenosine tetraphosphate pyrophosphohydrolase
MUSCLE (3.6) multiple sequence alignment


18440|gene|hbo      MPVQAVSAGAILFRDTRGRREYLLLKSRPGDWEFPKGGVEGKEELQQTAIREVKEEAGIQ
2391|gene|hwa       MTVEAVSAGAILFRDTRDQREYLLLKSRPGDWEFPKGGVEGEEELQQTAIREVEEEAGIE
878|gene|hut        -MIEATSAGAILFRDTRGQREYLLLKSRPGDWEFPKGGVEGEEELQQTAIREVKEEAGID
4092|gene|nph       -MIEATSAGAILFRDTRGRREYLLLKSRPGDWEFPKGGVEGNEELQQTAIREVKEEAGIE
10661|gene|hma      -MIEATSAGAILFRDTRGRREYLLLKSRPGDWEFPKGGVEGEEELQQTAIREVKEEAGIG
1315|gene|hhi       -MIEATSAGAILFRDTRGRREYLLLKSRPGDWEFPKGGVEGEEELQQTAIREVKEEAGIG
1402|gene|hla       MTVEATSAGAILFRDTRGEREYLLLKSRPGDWEFPKGGIEGDEELQQTAIREVSEEAGIE
431|gene|nrc1       MTVEATSAGAILFRDTRDRREYLLLKSRPGDWEFPKGGVEGDEELQQTAIREVQEEAGIE
                      ::*.***********. *******************:**.***********.***** 

18440|gene|hbo      EFRLVDGFREDYDYVFEANGKTIHKTVHLFIARSFEASAELSTEHRDLQWRDYEQALNTI
2391|gene|hwa       DFRLVDGFRKEYDYMFEAGGRTIHKTVHLFIAHSFEASAELSNEHRDLQWRDYQQALNTI
878|gene|hut        DFRLIDGFRKEYDYVFEANGETIHKTVHLFIAKSFEASAELSTEHHDHQWRDYEQAVNTI
4092|gene|nph       DFRLLDGFREDYDYVFEANGKTIHKTVHLFIARSFEASAELSEEHRDLQWRDYEQAINTI
10661|gene|hma      DFRLLDGFREDYDYVFEANGNTIHKTVHLFVAKSFEASAELSTEHRDLQWRDYEQAINTV
1315|gene|hhi       DFRLLDGFREDYDYVFEANGNTIHKTVHLFVAKSFEASAELSTEHRDLQWRDYEQAINTV
1402|gene|hla       DFRLIDGFRKEYDYVFEANGNTIHKTVHLFIARSFEASAEISNEHRDLQWRDYDQALNTI
431|gene|nrc1       DFRLVDGFRDEYDYVFEANGDRIHKTVHLFIAKSFEASAELSNEHSDLQWRDYDQAVNTI
                    :***:****.:***:***.*  ********:*.*******:* ** * *****:**:**:

18440|gene|hbo      TQDGPRDILKKAHTYLEDVATEDEEDGTRQYLA
2391|gene|hwa       TQDGPREIFEQAHDYLDELAAKNANRERPTYLP
878|gene|hut        TQDGPREIFEEAHDFIDEKEL------------
4092|gene|nph       TQDGPREILEEAHEFIDDYYEEDDEDESKA---
10661|gene|hma      TQDGPREILEQAHGFLDERTDDEE---------
1315|gene|hhi       TQDGPREILEQADEFLDERADDEE---------
1402|gene|hla       TQTGPREILEDAHDYLDERKDGDTGEYV-----
431|gene|nrc1       TQDGPREILEDAHVFIDEDADI-----------
                    ** ***:*::.*  ::::