HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0064COG0783arCOG01101DNA-binding ferritin-like protein (oxidative damage protectant)DNA Protecting protein under Starved conditions

HOG Organism Gene ID Name Annotation
cHOG0064 nrc1 VNG2443 dpsA DNA Protecting protein under Starved conditions
cHOG0064 hmu HMUK0390 Hmuk_0390 Ferritin Dps family protein
cHOG0064 hmu HMUK2289 Hmuk_2289 Ferritin Dps family protein
cHOG0064 hma RRNAC0890 frt ferritin
cHOG0064 hwa HQ1586A dpsA DNA-binding protein
cHOG0064 hla HLAC0536 Hlac_536 Ferritin Dps family protein
cHOG0064 hla HLAC2401 Hlac_2401 hypothetical protein
cHOG0064 hbo HBOR22020 Hbor_22020 DNA-binding ferritin-like protein (oxidative damage protectant)
cHOG0064 hbo HBOR37650b Hbor_37650 DNA-binding ferritin-like protein (oxidative damage protectant)
cHOG0064 hut HUTA2003 Huta_2003 Ferritin Dps family protein
cHOG0064 hvo HVO_0536 HVO_0536 Nutrient-stress induced DNA binding protein.
cHOG0064 nph NP3658A dpsA DNA-binding protein
cHOG0064 hhi 1527 frt ferritin
MUSCLE (3.6) multiple sequence alignment


2401|hp|hla         ------------------------------------------------------------
3658|gene|nph       --MSTQETVRRQAGSVE-ETALNIDPEKAEQLVDALNTDLAATYVLYHQIKKHHWNVEGA
536|gene|hla        --MSTQKETRQRAGTVE-ENALRLESEKAEQIIEALNVDLADAYTLYHQLHKHHWNVEGA
37650|gene|hbo      --MSTQETVRRQEGTVG-ENPVRLDEDKVEQIVDALNTDLADAYVLYHQLHKHHWNVEGA
10890|gene|hma      MTMATQEHVRREFGNVE-ENELRLDKEKSEQVINALNQDLADTYTLYHQVKKHHWNVEGA
1527|gene|hhi       --MATQEHVRREFGNVE-ENELRLDKEKSEQVINALNQDLADTYTLYHQVKKHHWNVEGA
1586|gene|hwa       --MSTQQTVRLRADEVEGSDALRIDSERASQLVDALNTDLAATQTLYHQLKKHHWNVEGA
2443|gene|nrc1      --MSTQKNARATAGEVEGSDALRMDADRAEQCVDALNADLANVYVLYHQLKKHHWNVEGA
22020|gene|hbo      --MSTQENVRKRAGEVEGSEALRIDADRAEQIVNALNTDLAATYVLYHQLKKHHWNVEGA
2003|gene|hut       --MSQSEHVLKTAGEVEGSDGLRMDADRAEEIVDALNTDLAATYVLYHQLRKHHWNVEGA
                                                                                

2401|hp|hla         ---------------------MIAGRAQALGGVPLSGGANYEEHAPVSPEDADDF-----
3658|gene|nph       EFLDVHEYLGEVAADLEADADELAERAQAIGGVPLAGGATFEEHAPIDPEGDDVYDIRTS
536|gene|hla        EFRDVHVFLQEVYEDVEAAADEVAERLQALGGVPHASLTTLAENATVEPEDEDVYDIRTS
37650|gene|hbo      EHRDIHIFLQEAYEDVEDAADDVAERIQTLGGVPHASMTALSEAATVEAEDEDVYDIRTS
10890|gene|hma      EFRDLHLFLGEAAENAEEAADELAERAQALGGTPISSGKAQEEHASVEPEGQDVYDIRTS
1527|gene|hhi       EFRDLHLFLGDAAGNAEEAADELAERAQALGGTPVAGGKAQEEHASVEPEGQDVYDIRTS
1586|gene|hwa       EFRDLHLFLGEAADEAEEFADELAERAQALGGAPVSSPSAISERSPVEPENEDVYDIRTS
2443|gene|nrc1      EFRDLHLFLGEAAETAEEVADELAERVQALGGVPHASPETLQAEASVDVEDEDVYDIRTS
22020|gene|hbo      EFRDLHLFFEEAYENAEEFADELAERVQALGGVPIAGGKALEEHAPVEPEGEDVYDIRTS
2003|gene|hut       EFRDLHLFLGDAAENAEAFADELAERVQALGGVPHASGATLEAESPVEPEDENVYDIRTS
                                          :* * *::**.* :.       :.:. *. : :     

2401|hp|hla         ----------------------AGAGDNPSAASTSLVFSPESGSRSAITDYRPDS-----
3658|gene|nph       LENDIEAFGVIIDSLRDHIELANDLGDYTTEELLRDVLAGVEEHAHHLEHYLEDDTLVLD
536|gene|hla        LANDLEMMGDIIESYREHIELAEGLGDYATAEMLREQLEGIEGHAHHIEHYLEDDTLVVE
37650|gene|hbo      LSNDLEMYGDIIESYREHIELIEGLGDYATGEMLREQLMDIEEHAHVIDHYLEDDTLVLE
10890|gene|hma      LENDLEMYGDIIESLRDHIDLAENLGDHATAQILREIIVQTEEDAHHIEHYLEDDTLVLD
1527|gene|hhi       LENDLEMYGDIIESLRDHIDLAENLGDHATAQILREIIVQTEEDAHHIEHYLEDDTLVLD
1586|gene|hwa       LGNDMEMYGDIIETLRDHIELAERLNDPTTAHMLRENLIEVEDAAHHIEHYLEDDTLVVE
2443|gene|nrc1      LANDMAIYGDIIEATREHTELAENLGDHATAHMLREGLIELEDDAHHIEHYLEDDTLVTQ
22020|gene|hbo      LRNDMEMYGDIIENLREHVELADSLGDHATSYMLRENLEDVEDDAHHIEHYLEDDTLVTE
2003|gene|hut       LENDLEMYGDIIETLREHVELFDNLGDPTTAEIIRENIVTVEEDAHHIEHYLEGDTLVTA
                                             .* .:       :   .     :  *  ..     

2401|hp|hla         ------
3658|gene|nph       SATK--
536|gene|hla        SATN--
37650|gene|hbo      SATK--
10890|gene|hma      ------
1527|gene|hhi       ------
1586|gene|hwa       SAMQ--
2443|gene|nrc1      GALE--
22020|gene|hbo      SAVNNE
2003|gene|hut       DAME--