HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0639COG3365arCOG04416Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0639 nrc1 VNG2408 vng2408 no entry
cHOG0639 hmu HMUK0813 Hmuk_0813 conserved hypothetical protein
cHOG0639 hma RRNAC2709 hypothetical protein
cHOG0639 hwa HQ3737A hypothetical protein
cHOG0639 hla HLAC2745 Hlac_2745 hypothetical protein
cHOG0639 hbo HBOR02090 Hbor_02090 uncharacterized conserved protein
cHOG0639 hut HUTA1616 Huta_1616 conserved hypothetical protein
cHOG0639 hvo HVO_3013 HVO_3013 conserved protein
cHOG0639 nph NP0592A hypothetical protein
cHOG0639 hhi 3104 HAH_3104 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


592|hp|nph         MPEITADDG------DGPDDDGIQIDMISAERMEGMRTMEKIRLILDGVHDGNIVILEQG
2408|chp|nrc1      --------------------------------MNGKTSMEKIRLILDSVREGDIVVLESG
3737|hp|hwa        MPEVTPDET------EDPHIDGVQIDMISGSRMEDLATMEKIRLILDGVREGNIVILEEG
2745|hp|hla        MPGPTPNVGGDDAPSDDSD-DGVRIDMISGARMDGLTGMEKIRLILDGVRDGNIVILEEG
2090|hp|hbo        -MSTVPEVT------T-GD-NGVQIDLISAARMDGLASMEKIRLILDGVRDGNIVILEEG
12709|hp|hma       ----MAEVK------D-PD-DGVQIDLISGERMAGLASMEKIRMILDGVRDGNIVILEEG
3104|hp|hhi        ----MAEVK------D-PD-DGVQIDLISGERMAGLASMEKIRMILDGVRDGNIVILEEG
1616|chp|hut       ----MAEVT------NKPR-DGVQIDLISGQRMEGMASMEKIRMILDGVRDGNIVVLEEG
                                                   * .   *****:***.*.:*:**:**.*

592|hp|nph         LEPDEESKLIEVTMSEINPDGFTGIEIETYPGEESGGSGLLGRIMGKDDSNKLTVIGPAN
2408|chp|nrc1      LTPDEESKLIEVTMSEINPDGFSGIEIESFPQSETSNTTLLGRLMGAQETSKLTVIGPAN
3737|hp|hwa        LSPDEESRLIEVTMTEISPDEFNGIEIETYPQSTANNTSLFGRLIGGESPQKLTVIGPAD
2745|hp|hla        LSPDEESKLIEVTMTEISPDDFTGIEIETYPKAETGDQSFLDKLMGRNSTQKLTVIGPAN
2090|hp|hbo        LSPDEESKLIEVTMTEISPDEFNGIEIESYPQSK-GGQGFLGRLMGKEETKKLTVIGPAN
12709|hp|hma       LSPDEESRLIEVTMTEISPDEFNGIEIETYPKSEAADASILDRLMGKQSTQKLTVIGPAN
3104|hp|hhi        LSPDEESRLIEVTMTEISPDEFNGIEIETYPKSEAADASILDRLMGKQSTQKLTVIGPAN
1616|chp|hut       LSPDEESRLIEVTMTEISPDEFNGIEIETYPRSETADQSFLDRLMGKESTKKLTVIGPAN
                   * *****.******:**.** *.*****::*     .  ::..::* :...********:

592|hp|nph         RIETLHKDETLISTLITRK
2408|chp|nrc1      QIQSLHKDETLISALISRQ
3737|hp|hwa        QIETLHKDENLISAFISHK
2745|hp|hla        QIETLHKDENLISTLVSRK
2090|hp|hbo        QIQTLHKDENLISALVSRK
12709|hp|hma       QIETLHKDETLISALVSRK
3104|hp|hhi        QIETLHKDETLISALVSRK
1616|chp|hut       QIETLHKDETLISALVSRK
                   .*::*****.***::::.: