HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0637COG2236 COG0005KOG3984 KOG3985arCOG00040purine phosphoribosyltransferase

HOG Organism Gene ID Name Annotation
cHOG0637 nrc1 VNG0335 gptA1 purine phosphoribosyltransferase
cHOG0637 hmu HMUK0850 Hmuk_0850 phosphoribosyltransferase
cHOG0637 hma RRNAC1757 gptA purine phosphoribosyltransferase
cHOG0637 hwa HQ1260A prt phosphoribosyltransferase
cHOG0637 hla HLAC0430 Hlac_430 phosphoribosyltransferase
cHOG0637 hbo HBOR25240 Hbor_25240 predicted phosphoribosyltransferase
cHOG0637 hut HUTA2740 Huta_2740 phosphoribosyltransferase
cHOG0637 hvo HVO_0694 HVO_0694 gptA purine phosphoribosyltransferase
cHOG0637 nph NP1204A phosphoribosyltransferase
cHOG0637 hhi 2289 gptA purine phosphoribosyltransferase
MUSCLE (3.6) multiple sequence alignment


11757|gene|hma      MGELPDEFSCTITDWEYIYGLCRDVADDVKAAEFEPDVVVALARGGWFGGRCLCDFLGLD
2289|gene|hhi       MGELPDEFSCTITDWEYIYGLCRDVADDVKAAEFEPDVVVALARGGWFGGRCLCDFLGLD
2740|gene|hut       MADLPEEFPCTITNWEYIYGLCRDVSDDVKADDFEPDVVVSLARGGWFAGRTLCDFLGLD
335|gene|nrc1       MSDLPDDFNCTITNWEYIYGLCRDVSDQVKAADFEPDVVVALARGGWFAGRCLCDFLGLN
430|gene|hla        MSDLPDDFDCTLTNWEYIYGLCRNVSNAVKRADFEPDVVVALARGGWFAGRCICDFLGLN
1260|gene|hwa       MSDLPDQFNCTITNWEYIYDLCRDVSNQIRADSFDPDVVVALARGGWFAGRCLCDFLGLD
25240|hp|hbo        MGDLPDEFNCTITNWEYIYGRCRDVSDQVKGAEFDPDVVVALARGGWFAGRCICDFLGLD
1204|gene|nph       MSDLPDEFNCTVTNWEYIYSLCRDVADHVKAAEFEPDVVVALARGGWFAGRCLCDFLGLD
                    *.:**::* **:*:*****. **:*:: :.  .*:*****:*******.** :******:

11757|gene|hma      DLASLKVEHYVGTAAKGEEAQVKYPLADGAVEGKDVLVVDDIADTGQSIETAAECVRDRN
2289|gene|hhi       DLASLKVEHYVGTAAKGEEAQVKYPLADGAVEGKDVLVVDDIADTGQSIETAAECVRDRN
2740|gene|hut       DLTSLKIEHYVGTAAKSQEPEVRYPMPEGSVAGKDVLIVDDIADTGQSLEHAYEYVSERD
335|gene|nrc1       DLTSLKMEHYVGTAEKSAEPEVRYPMPEGSVEDKDVLIIDDIADTGGSIEHAHEYVQDRD
430|gene|hla        DLTSLKMEHYVGAAEKSDEPQIRYPMPEGSVEGKDVLIIDDIADTGGSIRRAEEYVDDRD
1260|gene|hwa       DLTSLKMEHYVGTAQTTNEPEIRYPMPQGSVAEKDVLIIDDIADTGGSIERAYEYVTDRD
25240|hp|hbo        DLTSLKMEHYVGTAQKSGEPEVRYPMPEGSVEGKDVLIIDDIADTGGSIERAYEYVTERD
1204|gene|nph       DLTSLKMEHYVGTGQKSDEPQVRYPMPEGSVEGKNVLVIDDIADTGGSISRAYEYVTERD
                    **:***:*****:. .  *.::.**:.:*:*  *:**::******* *:  * * * :*:

11757|gene|hma      PSSVRTATLQLLQTSDHEPEFVGESLDEWTWVVYPWNFVEDMVELVAGVMAKSDQQTHTE
2289|gene|hhi       PSSVRTATLQLLQTSDHEPEFVGERLEEWTWVVYPWNFVEDMVELVAGVMEKSDQQTHNE
2740|gene|hut       PNAVRTATLQLLQTSEFEPDFVGERLAEWVWVVYPWNFIEDMTDLISSVMAKADAETFSE
335|gene|nrc1       ANAVRTATLQLLQTSAFEPDYVGERLDEWAWIVYPWNFIEDMIDIIAGVMATDDDGPYTT
430|gene|hla        AGEVRTATLQLLGTSEFQPDFVGERLEQWTWVVYPWNFLEDMIDLTEGAMERADQTVFDR
1260|gene|hwa       PNIVRTATLQLLQTSAFEPDFIGERLETWAWVVYPWNFIEDMTDLLTGVMRKTDAETFTI
25240|hp|hbo        AGEVRTATLQLLQTSEFEPDFVGERLEEWTWVVYPWNFIEDMIDLTTGVMEKADQATFDV
1204|gene|nph       AAEVRTATLQLLDTSEFEPEFVGERLETWTWVVYPWNFIEDMIELIGGVMEKADADTFSR
                    .  ********* ** .:*:::** *  *.*:******:*** ::  ..*   *   .  

11757|gene|hma      DDIRRLLREYHGVSRTNLEIAQPNRLGEVTTEMERRGVVES-------------AGDG--
2289|gene|hhi       DDIRQLLREYHGVSRTNLEIAQPNRLGEVTTEMERRGVVES-------------VGDG--
2740|gene|hut       EDVRSLLRSYHEVDPIEMEIAQPDRMAEVLTEMERRGVIEY-------------AGED--
335|gene|nrc1       AGIRDLLADYHDVDRIQMEIAQPDRLTEVRSEMVRRDVLAA-------------TDAD--
430|gene|hla        EDVRHYLDEFHGIGRIEMEVAQAGRLDEVLDEMVRRDVADR-------------AGEN--
1260|gene|hwa       PDLREGLKEYHSVERIEMEIAQPDRMEEVLDEMQRRGYVEAVTTNEASGDTPVETGDDVS
25240|hp|hbo        EDIRHYLAEFHNVDRIEMEIAQPNRMSEVMSEMERRGFVET-------------TGDG--
1204|gene|nph       DDIRHYLSAYHGLERIEMEIAQPDRLDEVLAEMERRGAARK-------------VGDD--
                     .:*  *  :* :   ::*:**..*: **  ** **.                 .. .  

11757|gene|hma      ---WQLTDD-----
2289|gene|hhi       ---WQLTDD-----
2740|gene|hut       --AWRLAAED----
335|gene|nrc1       --RWALV-------
430|gene|hla        --AWTLAE------
1260|gene|hwa       QPTWRIVETDEVGV
25240|hp|hbo        --EWRLVENEGVGA
1204|gene|nph       --AWQPA-------
                       *  .