HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0635COG0035KOG4203arCOG04128Uracil phosphoribosyltransferaseuracil phosphoribosyltransferase

HOG Organism Gene ID Name Annotation
cHOG0635 nrc1 VNG2305 upp uracil phosphoribosyltransferase
cHOG0635 hmu HMUK0877 Hmuk_0877 uracil phosphoribosyltransferase( EC:2.4.2.9 )
cHOG0635 hma RRNAC2577 upp uracil phosphoribosyltransferase
cHOG0635 hwa HQ1029A upp uracil phosphoribosyltransferase
cHOG0635 hla HLAC2717 Hlac_2717 uracil phosphoribosyltransferase
cHOG0635 hbo HBOR02710 Hbor_02710 uracil phosphoribosyltransferase( EC:2.4.2.9 )
cHOG0635 hut HUTA1551 Huta_1551 uracil phosphoribosyltransferase
cHOG0635 hvo HVO_2981 HVO_2981 upp uracil phosphoribosyltransferase
cHOG0635 nph NP1408A upp uracil phosphoribosyltransferase
cHOG0635 hhi 3001 upp uracil phosphoribosyltransferase
MUSCLE (3.6) multiple sequence alignment


1551|gene|hut       MTIEDHERAKVVGHALARDTLTRLRDVETEQVAFRKGLVKLGRICGYEIVDGLLESETVT
1408|gene|nph       MPIEDRDDAHVITHALAKHTLSELRSDETDQVAFRNGLVELGRLCGYEIIDGMMDTEYVS
12577|gene|hma      MPIEQRGDASVVTHALARDELTRIRNVETEQVAFRKGLVRLGRICGYEIIDGRMETEYTE
3001|gene|hhi       MPIEQRGDASVVTHALARDELTRIRNVETEQVAFRKGLVRLGRICGYEIIDGRMETEYTE
2305|chp|nrc1       MTIEDRGDAHVITHSLAKHTLSRLRDTTTEQVSFRKGLVKLGRISGYEIIDGAMETEFTA
1029|gene|hwa       MPIEDRDNAYLITHALAKDTLSQLRDIETEQVAFRKGLVKLGRICGYEIIDGAMETEYAH
2717|gene|hla       MTIEDRDDAHLITHALAKDTLSRLRDVETEQVAFRKGLVKLGRICGYEIIDGAMETEYVP
2710|gene|hbo       MPIEDRDDAYLITHALAKDTLLRLRDVETEQVAFRKGLVKLGRICGYEIIDGVMETEYVT
                    *.**:.  * :: *:**.  *  :*.  *:**:**:*** ***:.****:** :::* . 

1551|gene|hut       VETPLTTTEGERVGEMDDVVIVNVLRAATPFVEGLLKAFPRAKQGVISAGRDEEGGMDTE
1408|gene|nph       ITTPLAETTGEVVKGLDDVVIVNVLRAATPFVEGLVEAFPHARQGVISAGRDEAAGMNED
12577|gene|hma      VQTPLTTTMGERVKGLEDVVIVNVLRAATPFVEGLLKAFPRARQGVISASRDEEAGMNDD
3001|gene|hhi       VQTPLTTMMGERVKGLDDVVIVNVLRAATPFVEGLLKAFPRARQGVISASRDEEAGMNDD
2305|chp|nrc1       FETPLTETTGERVTGLDDVVIINVLRAATPFVEGLLKAFPRAKQGVISAGRDEDAGMDAD
1029|gene|hwa       VQTPLTETTGEQVSGLDNIVIVNVLRAATPFVEGLLKAFPRAKQGVISAGRDEAAGMNQD
2717|gene|hla       VQTPLQETTGERVKGLDDVVIINVLRAATPFVEGLLKAFPRAKQGVISAGRDEEAGMTDD
2710|gene|hbo       VETPLTETTGEHVKGLDNVVIINVLRAATPFVEGLLKAFPRAKQGVISAGRDEEAGMDDD
                    . ***    ** *  ::::**:*************::***.*.******.*** .**  :

1551|gene|hut       GRFDISIEYVKMPAIHEEDTLILADPMLATGSTMCAVLEEVLDG---ADPERVIVLSAVS
1408|gene|nph       GEFPITVDYVKLPDIDADDTVIVADPILATGSTMVAVLEEVLEQ---GTPERLVVLSAVS
12577|gene|hma      GEFPISVEYVKLPEITEDDTVIIADPMLATGSTMATVLDYITSE--KTEPENLLVLAAVS
3001|gene|hhi       GEFPISVDYVKLPEITEDDTVIIADPMLATGSTMTTVLDYITSE--KTEPENLLVLAAVS
2305|chp|nrc1       GEFPITVDYVKLPDISEGDTVIVADPMLATGSTMCTVLDHVTDEMPAAGVEDLFVLSAVS
1029|gene|hwa       GMFPITIDYVKLPEITANDTVVVADPMLATGSTMCAVLDHVNDA-AKSKPKNLFVLSAVS
2717|gene|hla       GEFPITIDYVKLPEIRPEDTVIVADPMLATGSTMCAVLDHVLDE--ADAFEDLFVLSAVS
2710|gene|hbo       GEFPITIDYVKLPEITEKDTVIVADPMLATGSTMCAVLDHVLSN-AAAEPTDLFVLSAVS
                    * * *:::***:* *   **:::***:******* :**: : .         :.**:***

1551|gene|hut       APEGLDRLREEFPDVELLTVAVDDHLDDNGYIVPGLGDAGDRAFRTT
1408|gene|nph       APPGLARVNDSIPSADVLTVSVDERLDEDGYIVPGVGDAGDRAFGT-
12577|gene|hma      APEGIVRVSEAQPDADIISVAIDDELDEDGFIVPGLGDAGDRAFRTT
3001|gene|hhi       APEGIVRVSESQSDADIISVAIDDELDEDGFIVPGLGDAGDRAFRTT
2305|chp|nrc1       APDGLLRVGDQFPDADLLTVAIDDTLTDDGYIVPGLGDAGDRAFRTT
1029|gene|hwa       APEGLLHVGSEFSSADLLTVAIDDYLDDEGYIVPGLGDAGDRAFRTV
2717|gene|hla       APEGLVRVSESVPEADLLTVAIDDRLDDDGFILPGLGDAGDRAFRTV
2710|gene|hbo       APDGLLRVGGQFPDADLLTVSIDDHLDDDGYIIPGLGDAGDRAFRTK
                    ** *: .:    ...::::*::*: * ::*:*:**:******** *