HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0632COG1395arCOG04152Predicted transcriptional regulatorXre like HTH

HOG Organism Gene ID Name Annotation
cHOG0632 nrc1 VNG2112 xrlR4 Xre like HTH
cHOG0632 hmu HMUK0846 Hmuk_0846 transcriptional regulator, XRE family
cHOG0632 hma RRNAC2519 hypothetical protein
cHOG0632 hwa HQ3058A hypothetical protein
cHOG0632 hla HLAC0273 Hlac_273 transcriptional regulator, XRE family
cHOG0632 hbo HBOR28330 Hbor_28330 transcriptional regulator, XRE family
cHOG0632 hut HUTA1789 Huta_1789 transcriptional regulator, XRE family
cHOG0632 hvo HVO_0338 HVO_0338 predicted transcription regulator containing DNA-binding HTH
cHOG0632 nph NP1320A hypothetical protein
cHOG0632 hhi 2949 HAH_2949 XRE family transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


2112|chp|nrc1       --------------------------------------------MKVLVNIDAFDAETGA
273|gene|hla        MSRTALIENITAMLEDADFLVSDRCAVRPKSFDVAARRDEDLVLLKILGNVDALDAETGA
3058|hp|hwa         MSRSALVGNITAMLEDAGFLVSDRCAIRPKSFDVAARRGEDLVLLKILGNVDALDRMTGA
28330|gene|hbo      MSRSALVGNITAMLEDAGFVVSDRCAIRPKSFDLAARRGEDLTLLKVLGNIDAFDAATGA
1789|gene|hut       MSRSALVGNIIAMLEDAGFLVSDRCAIRPKSFDIAARRGEDTILVKILGNIDAFDGLTGA
1320|hp|nph         MSRSALVGNITAMLEDAGFTVSDRCAIRPKSFDIAARRGDDVLLLKVLANIDAFDGYTGT
12519|hp|hma        MSRSALVENVMAMLEDAGFLVSDRCAIRPKSFDIAARRGEDVLLLKILGNIDAFDAQTGG
2949|gene|hhi       MSRSALVENVMAMLEDAGFLVSDRCAIRPKSFDIAARRGEDVLLLKILGNIDAFDAQTGG
                                                                :*:* *:**:*  ** 

2112|chp|nrc1       EMRRLGTYLHATPLVVGLRTRDEDLDPGVVYFRHGVPVFNPDTAMELFVDGIPPLVYAAP
273|gene|hla        EMRRLGEYLQATPMVIGIRTRDEELKPGVVYFRHGVPVINPDTGYDLFVEGMPPLIYAAP
3058|hp|hwa         EMRRLGGYLDATPLVIGVRTRDEDLKPNVVYFRHGVPVLSPDTAMDLFVEGVPPLIYAAP
28330|gene|hbo      AMRRLGDYLSATPLVVGLRTRDEDLKPGVVYFRHGVPVMNPDTAMDLFLEGVPPLIYAAP
1789|gene|hut       EMRRLGEYLEATPLVIGLRTRDEELKPGVVYFRHGVPVFSPNTAMDYFVEEVPPLIYAAP
1320|hp|nph         EMRRLGEYLDATPLVIGLRTRDEELKPGVVYFRHGVPVFSPDTAMDLFIEEVPPLIYAAP
12519|hp|hma        EMRRLGTYLNATPIVIGLRTRDEELKPGVVYFRHGVPVLSPDTAMDLFVEEVPPLIYAAP
2949|gene|hhi       EMRRLGTYLNATPIVVGLRTRDEELKPGVVYFRHGVPVLSPDTAMDLFVEEVPPLIYAAP
                     ***** ** ***:*:*:*****:*.*.**********:.*:*. : *:: :***:****

2112|chp|nrc1       GGLYVNIDGDVLADRREDERLSLGQLASELGVSRRTVSKYEDGMNASIEVAMRLEDLFGG
273|gene|hla        GGLYVSLDGDLLADEREERGWSLGRLATELGVSRRTVSKYEDGMNASIEVAIQLEDLFNE
3058|hp|hwa         GGLYVNIDGDLLADEREERGWSLGRLATELGVSRRTVSKYEDGMNASIEIAIQLEEVFDE
28330|gene|hbo      GGLYVNIDGDLLADEREKRGWSLGRLATELGVSRRTVSKYEDGMNASIEVAIHLEELFDQ
1789|gene|hut       GGLYVNIDSDILADAREERDWSLGKLANELGVSRRTVSKYENGMDASVEVAATLDDLFEE
1320|hp|nph         GGLYVNIDGDLLSDIRSQEDMSLGKLANELGVSRRTVSKYEDGMSASVEVAAELEEIFDR
12519|hp|hma        GGLYVNIDSEILADVREDRDWSLGRLAKELGVSRRTVSKYEDGMDASVEVAAELEDLFDA
2949|gene|hhi       GGLYVNIDSEILADVRENRDWSLGRLAKELGVSRRTVSKYEDGMDASVEVAAELEDLFDA
                    *****.:*.::*:* *..   ***.**.*************:**.**:*:*  *:::*  

2112|chp|nrc1       ELTAPVDVMDGAEDVRDTDPTPDDPEAAPEDVPVLSVLARVGFEVHPTVQAPFKAVGEAG
273|gene|hla        PFSSPVDVLDGAGEVRDADPTPSAPETDPDDEHVLHVLTNAGFTVHPTARAPFKAVSEDE
3058|hp|hwa         PFSSPLEVMEGAESVRDSEPTPDDPDPDADDEHVVHILTRAGFTVHPTARAPFKAVGEDD
28330|gene|hbo      PFSSPVSVLDGAEEVRDAEPTPEDPDADPDDEHVLHILTRAGFTVHPTARAPFKAVSEDE
1789|gene|hut       PLTSPVNVLEESEDVREDDSMPDEPEVDPDDEQLVTVLTRVGFDVHPTNRAPFKTVSEDE
1320|hp|nph         KLASPVEVLSGAEEVRDDVDEPEAPEADPDDAEIVTVLTRVGFEVHPTMQAPFKAVSEDE
12519|hp|hma        PLTSPVSVLDGAEEVRDDEPTPDDPDVAPEDEPIVTVFTRIGFEVHPTDRAPFKSVNESD
2949|gene|hhi       PLTSPVSVLDGAEEVRDDEPTPDDPAVAPEDEPIVTVFTRIGFEVHPTDRAPFKSVNESD
                     :::*:.*:. : .**:    *. *   .:*  :: :::. ** **** .****:*.*  

2112|chp|nrc1       AGHD---RLLTGHSAFTEAAVKRARIMSSVGEVTHTRAVYVVDE-AGRESVDDTAIVERE
273|gene|hla        GSSPA--RVLTGHSTFTPAAEKRARIMSSIGEVARTRSVYFTEENEDRESVDGTALVSCE
3058|hp|hwa         DNRRGVMSLLTGHSSFTKSAKKRARIMSSLGEVTQTRAVYFTETDAKRDAVKGTALVSCA
28330|gene|hbo      DKRSDQIPMLTGHSTFNRSAKKRARIMSSLGQVTQTRSVYFTKEQSKRDSVEGTALVSCD
1789|gene|hut       DEAEAD-RMLTGHSKLNEAARKRARIMASVGRVTGARSVYVVER-ATRESLEGTALVEES
1320|hp|nph         KRER---KVLTGHSEFNRTAEKRARIMSSVGHVTRTRSVYVVDS-TKRDSVDGTALIERE
12519|hp|hma        DEHG---QVLAGHSAFTETAEKRARIMSSVGEVTRTRSVYVVDE-LRRESVEGTALIEKE
2949|gene|hhi       DEHG---QVLAGHSAFTETAEKRARIMSSVGEVTRTRSVYVVDE-LRRESVEGTALIEKE
                            :*:*** :. :* ******:*:* *: :*:**...    *:::..**::.  

2112|chp|nrc1       ELANVDDSEDLRDLLADRGDLQEA--
273|gene|hla        ELADISDPEGIRELIRDRAKAPSEA-
3058|hp|hwa         ELDAVDDPAAIRDLIRERSQKPTEA-
28330|gene|hbo      ELAAIDDPDEIRDLIRERADEPTEA-
1789|gene|hut       EMDDIEVAEELRELIRERSEKPA---
1320|hp|nph         EFERIHDSDELENLIRERAEG-----
12519|hp|hma        EMENIEDAIDLRDLIMERGEDREEVA
2949|gene|hhi       EMENIEDAIDLRDLIMERGEEPEEVA
                    *:  :  .  : :*: :*..