HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0631COG0494KOG4313 KOG2839 KOG2937 KOG3041 KOG3069arCOG01072NTP pyrophosphohydrolases including oxidative damage repair enzymesNTP phosphohydrolase

HOG Organism Gene ID Name Annotation
cHOG0631 nrc1 VNG0274 mtl2 NTP phosphohydrolase
cHOG0631 hmu HMUK3018 Hmuk_3018 NUDIX hydrolase
cHOG0631 hma RRNAC1863 mutT4 Mut/nudix family protein
cHOG0631 hwa HQ1178A nudix family protein
cHOG0631 hla HLAC0778 Hlac_778 NUDIX hydrolase
cHOG0631 hbo HBOR24510 Hbor_24510 NUDIX family protein
cHOG0631 hut HUTA1193 Huta_1193 NUDIX hydrolase
cHOG0631 hvo HVO_0762 HVO_0762 Mut/nudix family protein
cHOG0631 nph NP1302A nudix family protein
cHOG0631 hhi 2379 mutT5 Mut/nudix family protein
MUSCLE (3.6) multiple sequence alignment


274|chp|nrc1        ---MDLSGVAAHRPVRVTDQDRAAAVLVPVVDAADGAALVFTKRAADLSDHPGQMSFPGG
1193|gene|hut       ---MDLGPVAAHDPASVT-APREAAVLVGIVERPAGTHLLFTRRADHLEDHPGQMSFPGG
1302|gene|nph       MTGMDWERVAAHEPTAAVDGDREAAVLVPVIDRPDGYHLLFTKRAEHLGEHPGQMSFPGG
778|gene|hla        ---MDLTGLRRYTPEGVTRARREAAVLAPVIERDGEAHLLFTKRAAHLGEHPGQMSFPGG
11863|gene|hma      ---MQFDRVAAHEPVVVDDEPQEAAVIAPVVTRPAGEAILFTKRADHLSDHPGQMSFPGG
2379|gene|hhi       ---MQFDRVAAHEPVVVDDEPQEAAVIAPVVTRPEGEAILFTKRADHLSDHPGQMSFPGG
1178|gene|hwa       MLYMNLSAVNTHAPTPVIDAGRRAAVIAPIVRIGAERHVLFTKRADHLGEHPGQMSFPGG
24510|gene|hbo      ---MDLSRVSSCDAETLTDAGRQAAVIAPVLTRRGEDHVLFTKRADHLGEHPGQMSFPGG
                       *:   :    .       . ***:. ::       ::**.**  * :**********

274|chp|nrc1        GCEPRDPDCRSTAAREANEEIGLGRDEVAFAGQLDDIATITEYAVTPFVGRVPDREFDPD
1193|gene|hut       GSEPVDADLSETALREAREEVGLEPSEATIVGRLDDIRTVSEYSIRPFVGHVPDRSYEPN
1302|gene|nph       GREPVDSSLEATATREAHEEIGLKPSEADVRGRLDDIPTVSNYAVRPFIAAIPDREYVPD
778|gene|hla        GREPIDRTLTDTALREADEEVGMRPGEVDVVGRLDDTRTSSAYRVRPFVGVAPDREYVPD
11863|gene|hma      GREPEDDDLLRTALREANEEIGLDPLAVNVLGRLDDIRTITRYSVRPFVGRIPDRDYLPS
2379|gene|hhi       GREPEDEDLLRTALREANEEIGLDPLAVNVVGRLDDIRTITRYSVRPFVGRIPDRDYLPS
1178|gene|hwa       SHEPSDTDLRETALREANEEIGLDSTEAQFHGRLDDILTVTDYAVRPFVVGVPYREYHPD
24510|gene|hbo      SREPSDGDLRATALREAYEEIGLRSNEVEFFGCLDDIKTVTDYSVTPFVARVPDREYEPD
                    . ** *     ** *** **:*:    . . * ***  * : * : **:   * *.: *.

274|chp|nrc1        EREVDEVAVLSVSALTDPSNYDLEKR-IHPEYGTALVHFFHVDGYTVWGATARILVQFLD
1193|gene|hut       DGEVAEIAVLSVDALTDPANYETECR-DHPDHGSVQLHYFHVGDYTVWGATARILTQLLE
1302|gene|nph       EEEVAEIAVLSLSELTASENYESERR-EHANYGSVRIHYFRVDGYTVWGATGRMLVQFLE
778|gene|hla        ESEVAEVAVLPTRGLTDPANYESERRVDHPEYGDHRVHFFHVGGYTVWGVTGRMVVQLLE
11863|gene|hma      DEEVAEIVTLPVSELTDLDNYESEHR-DHPHYGEIRLHFFYVDGYTVWGATARMLVQLLE
2379|gene|hhi       DEEVAEIVPLPVSELTDLDNYESEHR-DHPHYGEIRLHFFYVDGYTVWGATARMLVQLLE
1178|gene|hwa       EREVAEIVSLPVSALTDLSNYELTRR-EHPVHGAIRLHFFYVNGYTVWGATGRMLVQLLE
24510|gene|hbo      EREVAEIAVLAVSDLTNLDNYESEER-MHPHYGKRRLHFFHVDGYTVWGATGRMLVQLLE
                    : ** *:. *.   **   **:   *  *. :*   :*:* *..*****.*.*::.*:*:

274|chp|nrc1        LAAGWTPPDRDPTVVELDPDYPETS-----
1193|gene|hut       LSTEWRVPRTLD--CQPETNPPA-------
1302|gene|nph       LATDWTPPETVDRVVDPDADYPV-------
778|gene|hla        RTTDWRAPEEVDRVVGADAELPI-------
11863|gene|hma      LATDWRVPPEPDRYMEPDDDLPPSVRDEAE
2379|gene|hhi       LATDWRMPPEPDRYMEPDDDLPPSVRDEAE
1178|gene|hwa       LTTDWSAPEEVDRVIDPDSDLPI-------
24510|gene|hbo      LTTDWRAPPEPDRVVDPDAELPL-------
                     :: *  *         : : *