HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0063COG0671KOG3146 KOG2822 KOG3030arCOG03058Membrane-associated phospholipid phosphatasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0063 nrc1 VNG2091 vng2091 no entry
cHOG0063 hmu HMUK2113 Hmuk_2113 phosphoesterase PA-phosphatase related( EC:3.1.3.9,EC:3.1.3.27 )
cHOG0063 hmu HMUK0710 Hmuk_0710 phosphoesterase PA-phosphatase related( EC:3.1.3.9,EC:3.1.3.27 )
cHOG0063 hma RRNAC2781 pap2a glucose-6-phosphatase
cHOG0063 hwa HQ3644A PAP2 family phosphatase
cHOG0063 hla HLAC2360 Hlac_2360 phosphoesterase PA-phosphatase related
cHOG0063 hla HLAC1288 Hlac_1288 phosphoesterase PA-phosphatase related
cHOG0063 hbo HBOR29520 Hbor_29520 PAP2 superfamily protein( EC:3.1.3.27,EC:3.1.3.9 )
cHOG0063 hut HUTA1536 Huta_1536 phosphoesterase PA-phosphatase related
cHOG0063 hvo HVO_0238 HVO_0238 glucose-6-phosphatase
cHOG0063 nph NP0190A homolog 1 to phosphatidylglycerophosphatase
cHOG0063 hhi 66 pap2a glucose-6-phosphatase
MUSCLE (3.6) multiple sequence alignment


190|gene|nph        ------------------------MSRAIGETATVAG-LPEWVVSAAVVVTALGDVWFVF
1288|gene|hla       ---------------------MFPEGRSIGVTEALHGSVPDPVLVLFALLTQLGDVWFLF
12781|gene|hma      ------------------------------------------------------------
66|gene|hhi         ------------------------MIRAVGVTEVLSA-LPGAVVVLFALITQLGDFWFTF
2091|hp|nrc1        ------------------------------------------------------------
2360|gene|hla       ------------------MTGLVTAERGIGEVTLVDA-LPELVVVAFAAVTHLADPWFLF
1536|gene|hut       ----------------------------------MAS-LDAAVWFGVSLVTLLGDPLVIA
29520|gene|hbo      MYTHSSAAASASGGALAGAGGLTFASRGVGELAVVES-IPDTIVSLFSVLTHLGDPWVCL
3644|gene|hwa       --------------MISPSVLSVLATRGIGELRVLSD-IPEIVVAVFRILTHLGSPYTLF
                                                                                

190|gene|nph        LFLGVLYWFGSALPGP-VSLSRPHSAFAVALALGGLALTTALKEWLRLPRPAGA-AEPTA
1288|gene|hla       LLGGMLYVAGDELPRW--GIDRRRGLFILGLLLTYVALIGVLKGFFLFPRPVGA-GDPPV
12781|gene|hma      --------------------------MLVALLAVGVALVVSLKGVFALPRPPGA-GTATH
66|gene|hhi         LACGLLYWLGPWTPKLGRGLTRDRTAMLVALLAVAVALVVSLKGVFALPRPPGA-GTATH
2091|hp|nrc1        ------------------------------MVGVGLAAIVLLKGMFAAPRPPAS------
2360|gene|hla       GLLAVGYWFASDRLA---ASPRRAGATAIAAVTCAYAATALGKAWFALPRPPGAIGPADV
1536|gene|hut       GLGFGLYWFGGWVPVIGDRLDELRVELAFATIAGALALSAALKTGFALERPPGA-AALPG
29520|gene|hbo      FGVSFAYVVGERI-----GIDRSAAAFVLGLGLGAVGLTVGLKELFALPRPPGA------
3644|gene|hwa       AMISILYLFGRRG-----LLVRRRAAFILAIEIAAIAITVGLKHLFALPRPPVS------
                                                        .     *  :   **  :      

190|gene|nph        AGLLTMLPPSAHAQVAAADGFGFPSGHAVAAIVVYGGLALLIDS----RRGYAVAGLLCL
1288|gene|hla       VRWVPSVLQWVFADITTADGPGFPSGHTFGSTLVWGGFALIVGEGKRSRAWLAFAGAVVG
12781|gene|hma      AELLPAALRGVYESMATGEGFGFPSGHATLSLLVWGGIAWALRVGTR-RQRTAVAATIVA
66|gene|hhi         AELLPAALRGVYESMATGEGFGFPSGHATLSLLVWGGIAWALRVGTR-RQRAAVAATIIA
2091|hp|nrc1        ------------VAHVTAHGTGFPSGHAIGSAVLYGGLAALLDVGGR-RQRYAAGAAMVV
2360|gene|hla       PAWLPSLLSAWYEAQVLSDGFGFPSGHATGGAAAYLALALVYDRAWTGQRRLLAAVLVAV
1536|gene|hut       TAGMPDIVVPIYTWIVGPGGHAFPSGHATAATVGWLGLAWAYRGKNR-DRALVLAGGLVV
29520|gene|hbo      ----------------AEPGYGFPSGHTLGATVFWGGTALAANVGRR-RLRLGVAAAAVV
3644|gene|hwa       ----------------YRSGFGFPSGHAIGTTVFWGAAALLTERWQW-WRRVALAGGVII
                                       * .*****:      : . *               .     

190|gene|nph        LIPLSRVVIGVHYLVDILVGLALGGG-YLAAVYRLC-GRGDAPGR--------------A
1288|gene|hla       IVSLSRLVLGVHYLVDVVVGVGLGLV-VLGALYVVA-DRGTVPGR--------------V
12781|gene|hma      LIGLSRLVLGVHYLADIVAGFAIAGT-ALVLALSAL----KTPER--------------V
66|gene|hhi         LIGLSRLVLGVHYLADILAGFAIAGA-ALALALGAL----KTPER--------------V
2091|hp|nrc1        VVSATRLALGVHYLVDVVAGAGVGVA-VVGGVLAVT---RRRVGY--------------G
2360|gene|hla       AVAASRVVIEVHYLVDVLAGLAVGGGVVLGALWLAGDPRVRRGGSAESEGGFDSRGATAA
1536|gene|hut       AIATSRVVLGVHRPHEVLAGIGVGLA-YLFVTFGLL----GRPRR--------------T
29520|gene|hbo      AVAASRVIIGVHYLADVIAGVTVGVA-FLAIVFAAG-PGLRRPAA------PSDRTVIMC
3644|gene|hwa       IVAASRVIIGVHYVVDVFAGIAVGVA-LLALIIMTVGSGLEMGGNMSALVRPTHTDVTAM
                     :  :*: : **   ::..*  :.    :                               

190|gene|nph        ------MMIALLVAVVGAAI-------HYGQDTMLALGGTLGARIAWGIVGGAVAHEETT
1288|gene|hla       ------LLVSVGVGVLGLLQ-------GASFESVAALGSAVGAWLVWRGVADSTPAHPSN
12781|gene|hma      ------FGFAAVIAVAGLFV------TGISRNSAGALGVAVAGAVVWALLGDSIP--EPT
66|gene|hhi         ------FGFAAVIAVAGLFV------TGVSRNSAGALGVAVAGAVVWALLGDSIP--EPT
2091|hp|nrc1        ------FGLAVILAAGAVAV------AGPTTDAVAALGGAAGGLVGWRIVAARGAVGRAV
2360|gene|hla       LDPTLPFLLAAVVSTGALAVTVAGGHTGEVVEAGIGIATGAGGAVGWRLV-------DGD
1536|gene|hut       ------FALAGMIGVAGPIV------VGLTGDSLLVAGVALGMTVGWEFAR------ERD
29520|gene|hbo      ------YLAGGVISAAAAFT------NPIEIEVLLGVGTAVGGAAIWSVLGRAALDTNGD
3644|gene|hwa       ------FGVAAILTISSIMI------APNEIAVLLGTGMAATGATIWHKYGRTFGAIRVP
                             .  :   .                    .        *             

190|gene|nph        LLGGAV-STAVGLAFASGFAALYF-------------------VEPAPYVSFLGMSVVVA
1288|gene|hla       RREVGAGSVILGL--AGGFFALLY------------------VIEPPLLVAFFGSAIAVG
12781|gene|hma      RHGVGI-TALLGVVSVGTLLGVTF------------------ELDPTPGVITLLAGLGTG
66|gene|hhi         RHGVGI-TALLGVVSVGTLLGVTF------------------GLDPTPVAVTLLAGVGTG
2091|hp|nrc1        RPVAGV----GAVVAAGGVAAASV------------------GVGAGAIPVFGAHAAAGA
2360|gene|hla       EPAVPVRIAVPALAVTGGLWVGAY------------------VFAGSVAVTLAATTAAVV
1536|gene|hut       RPAVTL-PVLAAVIAAGGVAGATF------------------VRSGTFETGLALLGVGSG
29520|gene|hbo      LSTRSV--VVGAVAFPLPLVVMAA----------------VAELSMGSLAFVAAGAFGGV
3644|gene|hwa       ITLRAV--IIGGICITIGFTALITTVIMSTTVYVAQFETMINPISIASYA-IATGSLAAV
                               .:     .                                         

190|gene|nph        GVLVAPLVGEAVTRRL----
1288|gene|hla       STVAAPLAGEKLGGEYGA--
12781|gene|hma      VLLTLPLAGEQLAEKY----
66|gene|hhi         VLLTLPLAGEQLAEKY----
2091|hp|nrc1        VFVGLP-AAQNFSR------
2360|gene|hla       AVVALPALPERIERMSGAWN
1536|gene|hut       ATI---VAGQRVIRRVKNE-
29520|gene|hbo      TLLSLPVAVSSLFE------
3644|gene|hwa       IILASPSITARII-------
                      :        .