HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0629COG2404arCOG00423Predicted phosphohydrolase (DHH superfamily)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0629 nrc1 VNG2519 vng2519 no entry
cHOG0629 hmu HMUK0225 Hmuk_0225 RecJ-like exonuclease
cHOG0629 hma RRNAC2217 recJ4 RecJ-like exonuclease
cHOG0629 hwa HQ1067A hypothetical protein
cHOG0629 hla HLAC2163 Hlac_2163 hypothetical protein
cHOG0629 hbo HBOR03830 Hbor_03830 predicted DHD superfamily phosphohydrolase
cHOG0629 hut HUTA0964 Huta_0964 RecJ-like exonuclease
cHOG0629 hvo HVO_1824 HVO_1824 RecJ-like exonuclease
cHOG0629 nph NP1428A hypothetical protein
cHOG0629 hhi 2691 recJ5 RecJ-like exonuclease
MUSCLE (3.6) multiple sequence alignment


1428|hp|nph         MDDWLIDDETIPLHRRSILPGEGFFVPDSVDETETEQEARETLAGADRVVVADPDADGLG
964|gene|hut        MDDWLIDDDRLSIERKSILPGEGFFHPDTVEEIEREREAADTLADAGTVVIADPDADGLA
12217|gene|hma      MDDWLIDDDRLSIGRKSVLPGEGFFIPDSYEEEQAEAEAAETLQDAGVIVIADPDADGLA
2691|gene|hhi       MDDWLIDDDRLSIGRKSVLPGEGFFIPDSYEEEQAEAEAAETLDDAGVIVIADPDADGLA
2519|hp|nrc1        MEDWVIDDEDLSLERKSLLPGRGFFVPDDIHEARKDDAVRERVEGADVIVVADPDADGLA
2163|hp|hla         MDDELIDEADIPRSRYTRLPGKGFFYPDSLDDERAETRAKEVIEGSEAIVIADGDADGLA
1067|hp|hwa         MDDELINSAHLSLSRKSRLPGAGFFYPDSVDDD--DEDTHEAVANADVVVIADADADGLG
3830|hp|hbo         MEEELIDSSRLSLSRKSQLPGTGFFYPDSLDEERAEERVKEAVEDAEAVVIADTDADGLG
1824|gene|hvo       MEDELIDSSQLSLPRKSVLPGAGFFYPESFDEERAEERAKAKLEDASVAVVTDTDADGLG
                    *:: :*:.  :.  * : *** *** *:   :   :  .   : .:   *::* *****.

1428|hp|nph         CVALLRVAF---------------------------------DDA---------------
964|gene|hut        CVALIRDAF---------------------------------GEG---------------
12217|gene|hma      CTALIREAY---------------------------------GEG---------------
2691|gene|hhi       CTALIREAH---------------------------------GEG---------------
2519|hp|nrc1        CAAILREVY---------------------------------GDA---------------
2163|hp|hla         CAAMVREAYDAALDAADFEAAITARL----------------GDGESEADDGDSEDDPTE
1067|hp|hwa         CVALLREMYDATIAWDAFEPVVANRVTRWERGTDSTHTTDETTDASTDDPSSELTKISQE
3830|hp|hbo         CVALIREMYDATLDVAAFEDDVARRVERWE------------ADGPIDDEDEDE------
1824|gene|hvo       CVALLREAYDAALDVADFEERIEEKLADDE------------GDEDEDEDDEDESPLNEE
                    *.*::*  .                                  :                

1428|hp|nph         ------------------------------RLLPAGPHELADALAYIDEYGEPGADVFIC
964|gene|hut        ------------------------------ALLEASPHDLARAFEWVAEYLEPDTDVFVC
12217|gene|hma      ------------------------------ALLPAGPHELTEALEWTAEYADPDATVFIC
2691|gene|hhi       ------------------------------ALLPAGPHELTEALEWTAEYADPDATVFIC
2519|hp|nrc1        ------------------------------ALIPAGPHEIEDGLRRAVEYGNEDCRLFVC
2163|hp|hla         NAH----------------------TQSSVGLIAAGPYSIDTSLERVLAYADDDVDLFVC
1067|hp|hwa         TETEVKVENEHNNKDEDEDIVSTSSPESAVALITASPYSIDDALSTVAMEAPVGVDVYIC
3830|hp|hbo         -DEEL--------------------PRSTVALVGAGPYSLDDALERVAEYAPEDIDAYVC
1824|gene|hvo       AEEER--------------------PKSPVALMGSSPYSLEDDLQRVADYAPEGVEVYVC
                                                   *: :.*:.:   :         .   ::*

1428|hp|nph         DLCPDSPSDIE-RLQSVAEDAAAVRWFDHHQWDDDLTERVREHA-ELVVGDSDTVCTTDV
964|gene|hut        DLCPDEAADLA-GLDDIVARAGSVRWFDHHQWDEDLAGMVADAGVTLTVGESDEACTADV
12217|gene|hma      DLCPDRESDIA-PLDSLVDTAERVVWFDHHQWPDDLAADVDAAGVERTVGDSEEVCTADV
2691|gene|hhi       DLCPDRESDIA-PLDSLIERVERVVWFDHHQWPDDLAADVDAAGVERTVGDSEEVCTADV
2519|hp|nrc1        DVCPDRFEYVETELADATEHASELRWFDHHQWTAETAAAVRDAGVDLVVGDSEEECTADV
2163|hp|hla         DLCPDDYKWIAEPLEALAESTASIRWFDHHQWDESTAAAVRDLGVDLVVGESDEECTADV
1067|hp|hwa         DLCPDEFNWIETELTAVADRAETVAWYDHHQWDSSTADAVRDCGVELVIGASDEECSTDV
3830|hp|hbo         DLCPDQYEWVEDELAALLDRADSVSWYDHHQWDDETMVAVRDAGVELVVGESDEECSTGV
1824|gene|hvo       DLCPDKFEYVEEELAALVETAGEIHWYDHHQWKPEVAEAVRDAGVDLVVGESDEECSTDV
                    *:***    :   *      .  : *:*****  .    *   .   .:* *:  *::.*

1428|hp|nph         TLEAVAYDFPEQYAELAAVTRDHDLWLQEDPRSDDLADYAHWVEPETYVETVIEHGPDLP
964|gene|hut        ALAELDADFPDRFVDLTAVTRDHDLWIRDDPRSDDLADLAHWLEPEEYVEIIRAHGADLP
12217|gene|hma      ALSELDYDFDEQWADLAAVTRDHDLWIRDDPRSDDLADLSYWSEPEEYIEAVRDHGPDLS
2691|gene|hhi       ALSELDYDFDEQWADLAAVTRDHDLWIRDDPRSDDLADLSYWSEPEEYIEAVRDHGPDLS
2519|hp|nrc1        TVRSLDADIPERFRELAEVTRDHDLWLKDDDRSDDLADYSYWADTDEYMDTIQEYGADFP
2163|hp|hla         ALRSLDHDFDDRWAELAVVTRDHDLWIKEDSRSDDLADYSYWAGSEEYTTIVGAYGADLP
1067|hp|hwa         ALRSLPYEFESQWSELATVTRDHDLWIKEDARSDDLADYAYWAPPEEYATVVGTYGADLP
3830|hp|hbo         TLRSLDYDFDDRWTELAAVTRDHDLWLKEDERSDDLADYAYWVSPEEYVAVVGAYGVDLP
1824|gene|hvo       TLRELDYEFDERFSELAAVTRDHDLWLNEDERSQDLADYAYWTSKEEYVAVVGAYGADLP
                    ::  :  :: ..: :*: ********:.:* **:**** ::*   : *   :  :* *:.

1428|hp|nph         EEAVELLEERRVEKEALIEKAVERATFETVGEWTVGVTYGRCSQNEVAEAMREAGADASV
964|gene|hut        TDAEELLAERRIEKEALIEKAVERAQLREVGPWTVGVTYGRCSQNEVAEALREQGADAGV
12217|gene|hma      PEFHEFLDEKRVEKEALIEKAVDRAELRDVGEWTVGVTYGRCSQNEVAEALREQGADAAV
2691|gene|hhi       PEFHEFLDEKRVEKEALIEKAVERAELREVGEWTVGVTYGRCSQNEVAEALREQGADAAV
2519|hp|nrc1        DDVLAYIEQRRVEKHELIERAVDRASMKQIDEWTVGVTYGRCSQNEVAEALREQGADAAV
2163|hp|hla         ETVREFVADRRVEKDARIDAAVDRAVTHDIGEWTVAVTYGRCSQNEVAEALREQGADGAV
1067|hp|hwa         TLASRYLELRRVEKNALIDAAVDRAELTTVGPWTVGITYGRCSQNEVAETLRSQGADAAV
3830|hp|hbo         EIVEQFIELRRVEKQQLIDAALDRAEIKQVGPWTVGVTYGRCSQNEVAEGLRERGADAAV
1824|gene|hvo       PVVEEYIAHRRVEKENLIQAAVDRAELKTVGDWTVGVTYGRCSQNEVADALREAGADAAV
                          :  .*:**   *: *::**    :. ***.:***********: :*. ***..*

1428|hp|nph         IVKPAGSASIRGTEAFQRCHEVAQQVNGGGHPKAAGCKPDIYDDMLDYAHHWTTRGAVTK
964|gene|hut        IVKPAGSASIRGTENFERAHEVAAQVNGGGHPKAAGCKPDVYDDMLDYAHHWTTRGAVAK
12217|gene|hma      IVKPAGSASIRGTDSFERAHEVAQQVNGGGHPKAAGCKPDIYDDMMDYAHHWTTQGAVAK
2691|gene|hhi       IVKPAGSASIRGTDNFERAHEVAQQVNGGGHPKAAGCKPDIYDDMMDYAHHWTTQGAVAK
2519|hp|nrc1        VVKPSGSASIRGTETFERAHEVAGQVNGGGHPKAAGCKPDIYDDMLDYAAHWTSQGTTAK
2163|hp|hla         IVKPAGSASIRGSEDFQHAHEVAGKVNGGGHPQAAGCKPDIYDDMLDYAQHWTTEGQACK
1067|hp|hwa         VVKPAGSASIRGSETFERAHEVAGRLNGGGHPRAAGCKPDIYDDMLDYAHHWTTEGSPAK
3830|hp|hbo         VVKPAGSASIRGSDGFERAHEVAGQVNGGGHPKAAGCKPDIYDDMLDYAHHWTTNGAAAK
1824|gene|hvo       VVKPAGSASIRGSDDFERCHEVADLVNGGGHPKAAGCKPDIYDDMLDYAHHWTTQGATTK
                    :***:*******:: *:..****  :******.*******:****:*** ***: *   *

1428|hp|nph         QVILDAFRSLAD---EPA----------------EADA---
964|gene|hut        QAIVDAFRRLEV---EE------------------------
12217|gene|hma      QAIVDAFRRLPE---EEE----------------EGVDTDR
2691|gene|hhi       QAIVDAFRRLPE---EEA----------------EGVDTDR
2519|hp|nrc1        QVILDAFRALPD---EPA----------------DAE----
2163|hp|hla         RVILAAFEAVAE---EVA-----------AADESDETETDE
1067|hp|hwa         HIILQAFEEVAA---SL-----------------ETDPNSS
3830|hp|hbo         RVILAAFERVAE---QVAEESEDEEGAETADADDEADKTES
1824|gene|hvo       RVILRAFEQVADAVAEAEAEAAADAEADDDAEDDEGVETER
                    . *: **  :     .