HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0627COG0001KOG1401arCOG00918Glutamate-1-semialdehyde aminotransferaseglutamate-1-semialdehyde aminotransferase

HOG Organism Gene ID Name Annotation
cHOG0627 nrc1 VNG2326 hemL glutamate-1-semialdehyde aminotransferase
cHOG0627 hmu HMUK0914 Hmuk_0914 aminotransferase class-III( EC:5.4.3.8 )
cHOG0627 hma RRNAC2628 hemL glutamate-1-semialdehyde 21-aminomutase
cHOG0627 hwa HQ3447A hemL glutamate-1-semialdehyde 2,1-aminomutase
cHOG0627 hla HLAC2622 Hlac_2622 aminotransferase class-III
cHOG0627 hbo HBOR01390 Hbor_01390 glutamate-1-semialdehyde 2,1-aminomutase( EC:5.4.3.8 )
cHOG0627 hut HUTA1970 Huta_1970 aminotransferase class-III
cHOG0627 hvo HVO_0081 HVO_0081 Glutamate-1-semialdehyde 2 1-aminomutase
cHOG0627 nph NP1246A hemL glutamate-1-semialdehyde 2,1-aminomutase
cHOG0627 hhi 3046 hemL glutamate-1-semialdehyde 21-aminomutase
MUSCLE (3.6) multiple sequence alignment


2326|gene|nrc1      MNRETSRELYDRSLDVLVGGVNSTVRAAPQPYPTFVQSGDGGHVIDADGNRYIDWVMGLG
1246|gene|nph       MNHEGSRSLYDRALSVLPGGVNSAVRAAPQPYPVFADHGDGGHVIDADGNRYIDWIQGLG
1970|gene|hut       MNHERSRELYDRALSVAPGGVNSSVRAI-QPYPFFVEKGDGGHVIDADGNRYLDFVMGYG
12628|gene|hma      MNHEQSRALYDRALSVLSGGVNSSVRAT-RPYPFFVEKGDGGHVIDADGNRYIDFVMGYG
3046|gene|hhi       MNHEQSRALYDRALSVLSGGVNSSVRAT-RPYPFFVEKGDGGHVIDADGNRYIDFVMGYG
2622|gene|hla       MNHERSRGLYDRALSVMPGGVNSSVRAT-MPHPFFIERGDGGHVIDADGNRYVDWVMGYG
3447|gene|hwa       MTDEESRALYDRALSVMPGGVNSSVRAT-QPYPFFIERGDGATVIDADGTRYLDYVMGYG
1390|gene|hbo       MNHDESRALYDRALSVMPGGVNSSVRAT-QPYPFFIERGDGAHVVDADGNRYLDYVLGYG
                    *. : ** ****:*.*  *****:***   *:* * : ***. *:****.**:*:: * *

2326|gene|nrc1      PLLLGHDLPQPVTAAIQRRASDGPLFGTPTEIEVEHAEFVARHVPSVELLRFVNSGTEAT
1246|gene|nph       PLLLGHDMPEQLQAAVQSRASEGPMYGMPSEIEVEHAEFVCRHVPSVEMIRFVNSGTEAT
1970|gene|hut       PLLLGHDLPEQVQSAIQQRAAEGPMYGAPTEVEVELAEFVARHVPSVEMVRFVNSGTEAT
12628|gene|hma      PLLLGHSLPEQVQSAIQQHAAEGPMYGAPTEVEVELAEFVTRHVPSVEMLRFVNSGTEAT
3046|gene|hhi       PLLLGHSLPEQVQSAIQRHAAEGPMYGAPTEVEVELAEFVTRHVPSVEMLRFVNSGTEAT
2622|gene|hla       PLLYGHDLPDPVQAAIQSHVAAGPMYGAPTEIEVEHAEFVARHVPSVESIRFVNSGTEAT
3447|gene|hwa       PLLYGHDLPEPVNAAIQSYTSEGPMYGAPTPIEVEHAEFVARHVPSVEMIRFVNSGTEAT
1390|gene|hbo       PLLYGHDMPEPVRAAVQSHASEGPMYGAPTEVEVKHAEFVSRHVPSVEMIRFVNSGTEAT
                    *** **.:*: : :*:*  .: **::* *: :**: **** ******* :**********

2326|gene|nrc1      VSAVRLARGYTGRNKIVVMQGGYHGAQESTLVEGDADHRGPSSAGIPPAFAQHTIPVPFN
1246|gene|nph       VSACRLARAATGRNKIVVMQGGYHGAQESTLVEGDADDVAPSSAGIPQSFAEHTIPVPFN
1970|gene|hut       VSAVRLARGYTGRDKIVIMQGSYHGAQESTLVEGEGCHTSPSSPGIPESFAEHTITVPFN
12628|gene|hma      VSAVRLARGYTGRDKIVVMQSGYHGAQESTLVEGEGDHTAPSSPGIPESFAEHTLTVPFN
3046|gene|hhi       VSAVRLARGYTGRDKIVVMQSGYHGAQESTLVEGEGDHTAPSSPGIPESFAEHTLTVPFN
2622|gene|hla       VSAVRLARGHTGRDKIVVMQGGYHGAQESTLVEGSPGDAHPSTKGIPESFAEHTLPIPFN
3447|gene|hwa       VSAVRLARGYTGRDKIVVMKGGYHGAQESTLVEGDPMHVEPSTPGIPSSFAKHTLPVPFN
1390|gene|hbo       VSAVRLARAYTGRDKIVIMQGGYHGAQESTLVEGEPGDVHPSTRGIPESFAEHTIPVPFN
                    *** ****. ***:***:*:..************.     **: *** :**:**:.:***

2326|gene|nrc1      DADAVTEVFETHGDDIAAVLVEPILANKGIVEPVAGYHETLRDLTHDHGALLIWDEVITG
1246|gene|nph       DPEAASEVFRAHGDDIAAVLVEPVQANMGIVYPEDGYHEALRSLCDDYGSLLIFDEVITG
1970|gene|hut       DPEYVEGVFENHGDEIAAVLTEPILGNHGIVHPVEGYHETLRDLCDDYGSLLIFDEVITG
12628|gene|hma      DEEAAHEVFEEHGDDIAAVLTEPILGNYGIVHPVEGYHDTLRQLCDDHGSLLIFDEVITG
3046|gene|hhi       DEEAAHEVFEEHGDDIAAVLTEPILGNYGIVHPVEGYHDTLRELCDDHGSLLIFDEVITG
2622|gene|hla       DPQAAKKVFAEHGDDIAAVLVEPILANMGIVTPIDGYHETLRDLCDDHDSLLVFDEVITG
3447|gene|hwa       DLEAITTVFETHGEDIAAVLTEPILANNGIVRPVDGYLEHLRSLTTEHNSLLIFDEVITG
1390|gene|hbo       DFEAVRDVFETHGDDIAAVLTEPILGNKGIVMPVDGYLEHLRNLTEDHDALLVFDEVITG
                    * :    **  **::*****.**: .* *** *  ** : **.*  ::.:**::******

2326|gene|nrc1      FRVGGLGCAQSEFDITPDVTTFGKIIGGGFPVGAIGGRTDVMEEFTPTGDVFQAGTFSGH
1246|gene|nph       FRVGGLQCAQGKFDIDPDITTFGKIIGGGFPVGAIGGKTEYIEQFTPSGDVFQAGTFSGH
1970|gene|hut       FRVGGPQCAQGKFGIEPDVTTFGKIVGGGFPVGAIGGKSEIVESFTPAGDVFQSGTFSGH
12628|gene|hma      FRVGGLQCAQGAFDIDPDITTFGKIVGGGFPVGAIGGKSEIIEQFTPAGDVFQSGTFSGH
3046|gene|hhi       FRVGGLQCAQGAFDIDPDITTFGKIVGGGFPVGAIGGKSEIIEQFTPAGDVFQSGTFSGH
2622|gene|hla       FRVGGLGCAQSKFGVTPDVTTFGKIIGGGFPVGAIGGQAEIIEEFTPAGDVFQSGTFSGH
3447|gene|hwa       FRVGGLGCAQSKFGVTPDVTTFGKIIGGGFPVGAIGGRADIIEHFTPSGDVFQSGTFSGH
1390|gene|hbo       FRVGGLQCAQGKFGITPDVTTFGKIIGGGFPVGAIGGKSEIIEQFTPSGNVFQSGTFSGH
                    *****  ***. *.: **:******:***********.:: :* ***:*:***:******

2326|gene|nrc1      PVTMAAGLETLQYAAENDVYEHVNRLGGRLREGLAAVVAEHAPAYTVVGRDSMFKVVFTR
1246|gene|nph       PVTMAAGLETLKFCAEEDVYDHVNELGRQLREGLSDIVADQAPEYTVVGTDSLFKVVFTR
1970|gene|hut       PVTMAAGLETLRYAAENDVWEQVNELGAQMREGLTDIVADRAPEYTVVGSDSMFKVIFTR
12628|gene|hma      PVTMAAGLETLRYAAEHDVYGHVNDLGERLRAGLQDILEDQAPEYTVVGRDSMFKVIFTR
3046|gene|hhi       PVTMAAGLETLRYAAEHDVYDHVNELGDRLRAGLQDILEDQAPEYTVVGRDSMFKVIFTR
2622|gene|hla       PVTMAAGKASLEYAAENDVYEHVNRLGRKLREGITEICTERAPEYTVVGTDSMFKTIFTR
3447|gene|hwa       PVTMAAGYESLKYAAENDVYDHVNRLGERLRGGITDIATDQSPSAIVVGLDSMFKTVFER
1390|gene|hbo       PVTIAAGYEYLKYAAENDVYDHVNRLGEKLRRGITDIVEDQAPNYTVVGTDSMFKTVFTR
                    ***:***   * :.** **: :** ** .:* *:  :  :.:*   *** **:**.:* *

2326|gene|nrc1      DG-DAQSG-ACTDGCRQDPDCERHAACPKTGADVGDAAVQRWNRVFRPQLLDAGVLLSQN
1246|gene|nph       -GDGTPQGEACRNGCRQSSDCSRYGTCPTSATDVRDAETDRYARLFRPKMIEEGVLVSQN
1970|gene|hut       DGASGEN--HCGSGCRQRESCPSYDACPKNGADVDRAETERWERLFWPAMKDQGVFLTPN
12628|gene|hma      DGPDSLEG-QCEAGCQQQESCPRFEYCPKTGHDVTQAETERWERLFWPAMKDQGVFLTAN
3046|gene|hhi       DGPDSFDG-HCEAGCRQRESCPRFDYCPKTGHDVTQAETERWERLFWPAMKDQGVFLTAN
2622|gene|hla       DAPDDPDA-CCAGGCRQNPDCDRYDTCPKNGADVARAATDRWERVFWQEMKEQGVFLTAN
3447|gene|hwa       EGSTTDDGDVCSAGCEQRESCMRYDDCPKTGADVSSAETERWERIFWQEMRDHNIFLTAN
1390|gene|hbo       EGPADLDG-CCPAGCKQRESCPRYDYCPKNGADVAKADTERWKRIFWQEMKEQGVFLTVN
                     .    .   *  ** *  .*  .  **... **  * .:*: *:*.  : : .:::: *

2326|gene|nrc1      QFESQFVSYGHTEADVDETIEAYRSAL
1246|gene|nph       QFESNFVSYRHTAEDVEETLEAYKEAL
1970|gene|hut       QFESQFVSAAHTEADIEEALEAYKEAL
12628|gene|hma      QFESQFICDAHTGEDIENALEAYKEAI
3046|gene|hhi       QFESQFICDAHTGEDIENALEAYKEAI
2622|gene|hla       QFECQFTSYAHTEEDVEETLAAYREAI
3447|gene|hwa       QFESQFVSYAHTDEDIDRTLEAYKSAL
1390|gene|hbo       QFESQFVSYAHTDEDIEETLEAYKEAL
                    ***.:* .  **  *:: :: **..*: