HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0624COG1321arCOG02099Mn-dependent transcriptional regulatortranscription repressor

HOG Organism Gene ID Name Annotation
cHOG0624 nrc1 VNG0536 sirR transcription repressor
cHOG0624 hmu HMUK2694 Hmuk_2694 iron (metal) dependent repressor, DtxR family
cHOG0624 hma RRNAC0496 sirR transcription repressor
cHOG0624 hwa HQ1563A sirR transcription regulator SirR
cHOG0624 hla HLAC0657 Hlac_657 iron (metal) dependent repressor, DtxR family
cHOG0624 hbo HBOR23980 Hbor_23980 Mn-dependent transcriptional regulator
cHOG0624 hut HUTA2026 Huta_2026 iron (metal) dependent repressor, DtxR family
cHOG0624 hvo HVO_0819 HVO_0819 sirR transcription repressor
cHOG0624 nph NP2878A transcription regulator
cHOG0624 hhi 1144 sirR transcription repressor
MUSCLE (3.6) multiple sequence alignment


2026|gene|hut       --------MQTDVMEDYLKVIYRLEREEGAPVGTSAIADALDVTAPTATRMLEKLADEEL
10496|gene|hma      --------MLSAKMEDYLKAIYRLERDGDPPIAPSTIAEMLDVTAPTVTSMVEKLADRGL
1144|gene|hhi       -------------MEDYLKAIYRLERDGDPPIAPSTIAEMLDVTAPTVTSMVEKLADRGL
1563|gene|hwa       --------MLSDAMEDYLKSIYRLQAEKGPPVSTSAVADTLEKTPATVTSMFETLTDREL
2878|gene|nph       --------MLSAVMEDYIKAIYALQNDTDERVGTSELADYMDVTSPTVSSMIKKLEERGL
536|gene|nrc1       MHLNDGVGMLSDVMEDYLKSIYNLEREHEPPIATSTIAEYLDVTPPTVTSMAEKLESRGL
657|gene|hla        -------------MEDYLKAIYVLQSEQGPPVSTSAIAEYLDKTSPSVTDMLGKLEDRGL
23980|gene|hbo      --------MLSDVMEDYLKAIYQIQATSGPPVSTSAIAEYLGKTPPTVTSMLGKLEERGL
                                 ****:* ** ::      :..* :*: :  *..:.: *  .* .  *

2026|gene|hut       IEREKYSGVELTEHGRRIALETVRHHRLLEAYLVEHLDYEWGEVHDEAERLEHHISESFE
10496|gene|hma      VEREKYKGVQTTPEGETVALEIIRHHRLLETFLTEQLGYDWAEVHEEAEVLEHHISEEFE
1144|gene|hhi       VEREKYKGVRTTPEGETVALEIIRHHRLLETFLTEQLGYDWAEVHEEAEVLEHHISEEFE
1563|gene|hwa       LIYEKYEGVELTTEGETVALAVIRRHRLLESYLADQLGYKWSEVHGEADALEHHISEVFE
2878|gene|nph       VDREEYRGVRLTEEGEVVALEILRHHRLLEAFLTEHLDYDWADVHEEADRLEHHVSEELT
536|gene|nrc1       IEREKYAGVELTPDGETVAVEVIRHHRLLESFLATHLDYDWDEVHDEADALEHHISEEFE
657|gene|hla        VEREPYRGTELTAEGEAVALEIVRHHRLLEAFLAERLDYDWSEVHEEADALEHHISEAFE
23980|gene|hbo      VNREKYKGVELTEEGETVALEVLRHHRLLEAYLAEHLDYSWSEVHDEADALEHHISEEFE
                    :  * * *.  *  *  :*:  :*.*****::*. .*.*.* :** **: ****:** : 

2026|gene|hut       ERIADLLGHPPVDPHGEPIPGVDLEPPADADTRPLSSCESGERIVVATVRDRDEETLQYL
10496|gene|hma      RRVAAVLDEPEFDPHGDPIPSDSLDPIDDESATALSEHGEGGRLEVARVRDRDPDELTYL
1144|gene|hhi       RRVAAVLDEPEFDPHGDPIPSDSLDPIDDESATALSEHSEGGRLEVARVRDRDPDELTYL
1563|gene|hwa       RRVAAALDDPQVDPHGDPIPTADLTPLSDAASGPLSACEEGEHVVVVRVRDRDPTELEYL
2878|gene|nph       ERIAEALDNPGVDPHGDPIPDADLELPEAGETTRLTAAAEGDTVVVRRIRHQGDEELRYL
536|gene|nrc1       DRLAEKLGDPTVDPHGDPIPNADLEPPEHPDTEVLADHAEGDALVVARASDRNTDELRYL
657|gene|hla        RRVAETLDDPAVDPHGDPIPGADLEPVDEESGALLANHKEGDRVVVTRVSDRNEDELEYL
23980|gene|hbo      RRVAEALGNPTVDPHGDPIPSADLTPLEYDDTETLSDHPVGDHVVVTRVSDRDEEELEYL
                     *:*  *. * .****:***  .*          *:    *  : *     ..   * **

2026|gene|hut       ADSGIVPGRKVTVTDVTPVDVYVL-EHEEGT-----------------------------
10496|gene|hma      SDAGITPGTVLTIEEVAPIGMVTV-QLESGS-----------------------------
1144|gene|hhi       SDAGITPGTVLTIEEVAPIGMVTV-QLESGS-----------------------------
1563|gene|hwa       DRVGIRPGTELTIVDVAPFGMITV-AIGENDIDCGQTTMQTVSSSNISATADSTDHPSNT
2878|gene|nph       AAAGIEPDVEIEVVEIAPFGLVTV-QTPEGE-----------------------------
536|gene|nrc1       ADAGVQPGTELTVTEHAPIGLFVV-EIDGEA-----------------------------
657|gene|hla        ADAGITPGTEIEVVDVAPFGMVTV-TTPTGE-----------------------------
23980|gene|hbo      ADAGVTPGTKLEVVDVAPFGMVTVRTEDDGE-----------------------------
                       *: *.  : : : :*..: .:                                    

2026|gene|hut       --------------------------------------QHLSAAVAESVYVETPAEESDA
10496|gene|hma      -------------------------------------SVSLPDHIADAIQVRAPDTQGED
1144|gene|hhi       -------------------------------------SVSLPDHIADAIQVRAPDTQGED
1563|gene|hwa       ELLSAEQRISSDDNSNSLISTSIAESDNKPNGTTNVLTQSLPDDVAESVRIRSLDETANS
2878|gene|nph       --------------------------------------QSLPEEIARLIEI----DSDT-
536|gene|nrc1       --------------------------------------VHLPERVAETLEVRPAADEVTD
657|gene|hla        --------------------------------------QSLPAEIARSIRV----EDAG-
23980|gene|hbo      --------------------------------------QSLPESVAASIRVKPVDEDADG
                                                            *.  :*  : :         

2026|gene|hut       VPEEVPGL----------------
10496|gene|hma      GVSQA-------------------
1144|gene|hhi       GVSQA-------------------
1563|gene|hwa       SGIDSYAETHEQGNEPESDEVSNA
2878|gene|nph       ------------------------
536|gene|nrc1       A-----------------------
657|gene|hla        ------------------------
23980|gene|hbo      ANDEANGENGEAST----------