HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0623COG1718KOG2270arCOG01180Serine/threonine protein kinase involved in cell cycle controlpredicted serine/threonine protein kinase

HOG Organism Gene ID Name Annotation
cHOG0623 nrc1 VNG2233 stk predicted serine/threonine protein kinase
cHOG0623 hmu HMUK0701 Hmuk_0701 Non-specific serine/threonine protein kinase( EC:2.7.11.1 )
cHOG0623 hma RRNAC2476 prk2 protein kinase
cHOG0623 hwa HQ3398A RIO-like serine/threonine protein kinase II
cHOG0623 hla HLAC2660 Hlac_2660 protein of unknown function RIO1
cHOG0623 hbo HBOR00880 Hbor_00880 serine/threonine protein kinase involved in cell cycle control( EC:2.7.11.1 )
cHOG0623 hut HUTA1605 Huta_1605 Non-specific serine/threonine protein kinase
cHOG0623 hvo HVO_0135 HVO_0135 serine/threonine protein kinase
cHOG0623 nph NP1312A RIO-like serine/threonine protein kinase II
cHOG0623 hhi 2906 pkn2 non-specific serine/threonine protein kinase
MUSCLE (3.6) multiple sequence alignment


2233|chp|nrc1       ------------------------------------------------------------
3398|gene|hwa       MTDHDHDNNHENSGHRSDIDNAEDEAEAEADIESTDAEMSKINAETTDSDSGFVAPDVVD
880|gene|hbo        --------------------------------------------MTESEEFGLVEPAEAG
2660|gene|hla       ----------------------------------------------MSEEFVLLEPED--
1312|gene|nph       ----------------------------------------------MTEDDGLLSADDGE
1605|gene|hut       -----------------------------------------------MTEFGLIDDEGAE
12476|gene|hma      ------------------------------------------------------------
2906|gene|hhi       ---------------------------------------------MTEGQFGLLDTDDVD
                                                                                

2233|chp|nrc1       ------------------------------------------------------------
3398|gene|hwa       TPGNEWAEIDVSDTEADRIARRRDREFSTFRERLTDADQFKVEQSVFDDATFAAIYKLVQ
880|gene|hbo        TPGDEWESIDVTDTEADRIARKRDRKFDEFRKRLKDADQFKVEQSVFDDATFAAIYKLVQ
2660|gene|hla       QPGDEWEKLDVSDTEADRIARRQDREFDEFRKRIKDTEQFKLQESVFDDATLAAIYKLVQ
1312|gene|nph       QPGDEWEELDVSDTEADRIARAQDREFLEFRKRIKNTEQFKVEASVFDDATLGALYKLVQ
1605|gene|hut       LPGDEFEEIDVADTEADRIARRRDREFSEFRKRIKNTEQFKVEASVFDDATFAALYKLVQ
12476|gene|hma      ------------------------------------------------------------
2906|gene|hhi       SPGDEWEEVDVSDTEADRIARKRDREFSEFRERIKDADQFKVEASVFDDATYGALYKLVQ
                                                                                

2233|chp|nrc1       ------MGGPISTGKEANVYEALDA-----------------------------------
3398|gene|hwa       DDHIAAFGGPISTGKEANVYEARGT-----------------------------------
880|gene|hbo        DGHIDAFGGPISTGKEANVYEALGP-----------------------------------
2660|gene|hla       DGYVDAFGGPVSTGKEASVFEALGGQAGERPEPGSA----------------------AA
1312|gene|nph       DSYVDAFGGPISTGKEANIYTALA------------------------------------
1605|gene|hut       DGYIEAFGAPISTGKEANVYTALSGAQSRSAPDESSRPDRRSAESKAAEPRDYGDEPEPR
12476|gene|hma      ------------------------------------------------------------
2906|gene|hhi       DGHIDAFGGPISTGKEANVYTALS------------------------------------
                                                                                

2233|chp|nrc1       --------EGGDVALKVYRINASNFQQMRAYLEGDPRFEGLRGDKKAVVLSWTRKEFSNL
3398|gene|hwa       --------DTADVAVKIYRINASNFQQMRSYLEGDPRFDGLGQDKKAIVLAWTQKEFANL
880|gene|hbo        --------EDTDVATKIYRINASNFRHMRDYLEGDPRFEGIGNDKKRVVLAWTQKEFANL
2660|gene|hla       GGGPEGVHPEREVAVKVYRINSSNFRQMRDYLEGDPRFEGIASDKKAVVLAWTRKEFANL
1312|gene|nph       --------PDGEVAVKVYRINASDFKQMRAYLEGDPRFEGIGSDKKKVVVAWTKKEYANL
1605|gene|hut       DDGGRGTKGGHEVAVKVYRINASDFKDMRGYLDGDPRFEGIGSDKKKVVTAWVRKEFANL
12476|gene|hma      ---------------------------MRSYLDGDPRFEGIGSDKKKVVTAWVRKESSNL
2906|gene|hhi       --------GDTEVAVKVYRINASDFKDMRSYLDGDPRFEGIGSDKKKVVTAWVRKESSNL
                                               ** **:*****:*:  *** :* :*..** :**

2233|chp|nrc1       RRAKAAGVRVPAPLAVQRNVLVMELIGRE-GDAAPTLSDVDIENPQMAYEVVREYVRRLY
3398|gene|hwa       RRAMRAGVRVPEPIAVERNVLVMELVGLV-EERARRLAEVDIENPQTAYEVVQEYMQRLY
880|gene|hbo        ERARQAGVRVPEPIAVERNVLVMELVGLV-EDRARRLAEVSVENPQTAYEVVREYMRRLY
2660|gene|hla       ERARKAGVRVPEPIAVQRNVLVMELVGHA-EDRARRLSEVDVENPETAYEVVREYMRRLF
1312|gene|nph       ERARKAGVRVPEPIAVERNVLVMEYLGDD-DRRAKRLNEVHIENPETTYEVVREYMRRLY
1605|gene|hut       KRAQQAGVRVPNPIAVERNVLVMEYIATDAEGRAKRLNEVHIENPETAFEVLREYMRRLH
12476|gene|hma      KRARRAGVRTPEPIAVERNVLVMEYLGTE-EGRSKRLSEVHIENPETAYEVVKEYTRRLY
2906|gene|hhi       KRARRAGVRTPEPIAVERNVLVMEYLGTE-EGRSKRLSEVHIENPETAYEVVKEYTRRLY
                     **  ****.* *:**:******* :.      :  * :* :***: ::**:.** .**.

2233|chp|nrc1       DAGLVHGDLSEYNVVVYEGELVVIDVGQAVTIHHPNSATFLERDCRNVANFFARQGADAD
3398|gene|hwa       SAGLIHGDLSEYNMIIHNGELVVIDLGQAVTVHHPNAEMFLRRDCKNVATFFSRQGIDTD
880|gene|hbo        SAGLVHGDLSEYNMIIHDGELVIIDLGQAVTVHHPNADEFLRRDCRNVAKFFSRQGTDTS
2660|gene|hla       RAGLIHGDLSEYNMIIHEGELVIIDMGQAVTVHHPNAGEFLDRDCENVATFFTRQGIDVD
1312|gene|nph       DAGLVHGDLSEFNIVVHEGELCLLDLGQAVTVHHPNSREFLERDCENVAGFFARQGVDVD
1605|gene|hut       AAGLVHGDLSEYNVVFHEGELVVIDLGQAVTVHSPNAEDFLRRDCQNVANFFAGQGVEVT
12476|gene|hma      DAGLVHGDLSEYNIVFHEGQLYIIDLGQAVTIHHPNADDFLERDCRNVANFFARQGVDAT
2906|gene|hhi       DAGLVHGDLSEYNIVFHEGQLYIIDLGQAVTIHHPNADDFLERDCRNVANFFARQGVDAT
                     ***:******:*::.::*:* ::*:*****:* **:  ** *** *** **: ** :. 

2233|chp|nrc1       PDDLLSYVHEHATPRAEADTAAGDRDGTEGSLDRGSDADDA-------------------
3398|gene|hwa       PAALIETV---------------TEPDPDPSGTLAQSEHSVQSTDEES------------
880|gene|hbo        ATDLYEFV---------------TDVDADPTGDPDVDERDA-GTDE--------------
2660|gene|hla       PDDLYEYV---------------TEPEPDPSGEPESGGESKSGGESKSGGESKSGGESDK
1312|gene|nph       ADDLLAHV---------------TEPEPDPSGNAE-------------------------
1605|gene|hut       ADALYDYV---------------TDDEQQDYGSSAASKDT--------------------
12476|gene|hma      PEELLAYVREYATPKDKADTAPGSDDDAVPQGTPADRRDDE-------------------
2906|gene|hhi       PEDLLAYVREYATPKDKDDTAPGSDDDAVPQGTPADRRDEE-------------------
                    .  *   *