HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0620arCOG04723hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0620 nrc1 VNG2306 vng2306 no entry
tucHOG0620 hmu HMUK0882 Hmuk_0882 conserved hypothetical protein
tucHOG0620 hma RRNAC2582 hypothetical protein
tucHOG0620 hwa HQ1040A hypothetical protein
tucHOG0620 hla HLAC2707 Hlac_2707 hypothetical protein
tucHOG0620 hbo HBOR02800 Hbor_02800 hypothetical protein
tucHOG0620 hut HUTA1550 Huta_1550 conserved hypothetical protein
tucHOG0620 hvo HVO_2972 HVO_2972 conserved hypothetical protein
tucHOG0620 nph NP1406A hypothetical protein
tucHOG0620 hhi 3006 HAH_3006 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1406|hp|nph       ----------------------------------------------------------MD
1550|chp|hut      ------------------------------------------------------------
12582|hp|hma      MRHLYSDIKGWGGGSRESITAAATAETFNPTEQQSGVYRWTAHCSRSRGCHRPIYYTMAD
3006|hp|hhi       ---------------------------------------------------------MAD
2306|hp|nrc1      ------------------------------------------------------------
2707|hp|hla       ------------------------------------------------------------
1040|hp|hwa       ------------------------------------------------------------
2800|hp|hbo       ------------------------------------------------------------
                                                                              

1406|hp|nph       IEESVSGFKARGGWGDIVEHGERITRALRELDAEEDHDVDGDALEEWDEWRPKADERLGE
1550|chp|hut      MDESVSGFKVHGGWVDVVEHGERITRALRELAA--DHDVDTDALEEFDEWRPKSHERLDE
12582|hp|hma      IEESVSGFKTKGGWVDVVEHGERITQALKDIAS--GETVDEDALSEFDEWRPKSHERLDE
3006|hp|hhi       IEESVSGFKTKGGWVDIVEHGERITQALKDIAS--DEDVDNDALSEFDEWRPKSHERLDE
2306|hp|nrc1      MEESVAGFKQRGTWGDVVEHGERITTALREAGA--DEAF-ADAFAEWDDWRPKSHERIGD
2707|hp|hla       MEESISGFKVRGDWGDIVEHGERIALALR------ETGTDDDAFYEFDDWRPKSHERIDE
1040|hp|hwa       MQESVSGFEVRGTWGDVVEHGERITRALR------DADIDGEAFDEWNEWRPKSHERLGE
2800|hp|hbo       MEESVSGFKIRGTWGDVVEHGERITRALR------DAGVESDAFKQWDEWRPKAHERLSE
                  ::**::**: .* * *:*******: **.            :*: ::::****: **:.:

1406|hp|nph       DVSRKTAEQASVGEGEGEKAGKDPDEDLKTAGEKLSDSYESLE--EPGEAVDEWRESINY
1550|chp|hut      DVNEKTAQQARLDEGKGEKKGKDPDDDLRTAGEKLADSYENLD--EPDEAVDAWGESIDY
12582|hp|hma      DVNEKTADQASVDEGKGEQAGKGPDEDLQTAGEKLSESYENLD--EPDEAMERWSESVDY
3006|hp|hhi       DVNEKTADQASVDEGKGEQAGKGPDEDLQTAGEKLSESYENLD--EPDEAMERWSESVDY
2306|hp|nrc1      EVNEKTADQASVAEGKGEKAGASADEDLQKAGEQLSASYEKLGDGDGGDAVEKWQSSLDH
2707|hp|hla       DVSEKTAEQASVGEGEGEQAGKTPGGDLQTAGEKLTESYEKVEENDTESAMESWGESIGH
1040|hp|hwa       DVSQKTAAQASVSEGKGERAGKAPDEDLQTAGEMLSDSYDHVEAGESDSAVERWSDSLGY
2800|hp|hbo       DVNEKTAAQASVSEGQGEKAGKEPNEDLQTAGEKLSESYQKVDEGDNDGAVERWSESIGY
                  :*. *** ** : **:**. *  .. **..*** *: **: :   :   *:: * .*:.:

1406|hp|nph       VARAADSATRKALRKVEGSVYRNVMTQMSPYYFDNELVSANLTR-GDSAADD-YIFEVNI
1550|chp|hut      VARAADSAGRKAIRAVEDKVYRNVMTQVAPYYFDNDLISANLRRVEDED-PE-YVFEVNV
12582|hp|hma      VARAADSASRKALRKVEDTVYRNVMTQIAPYYFDNDLISANLRRVGDEERPE-YVFEVNV
3006|hp|hhi       VARAADSASRKALRKVEDTVYRNVMTQIAPYYFDNDLISANLRRVGDGDRPE-YVFEVNV
2306|hp|nrc1      VKRAADTAGRKAIRKVEDAVYRNVMTRIAPYYFDNALVSANIQRVRSQEE---FVFEVNI
2707|hp|hla       VARAADSASRKALRKVEDTVYRKVMTQMAPYYFDNELVSANVQEVGRGENGETFVFEVNV
1040|hp|hwa       VARAADSAGRRALRRVEDTVYQRVMTQLAPYYFDNTLISANIQKTTRGDAAVAFIFEVNI
2800|hp|hbo       VARAADSAGRKALRKVEDTVYRKVMTQLAPYYFDNELVSANIQKSARGEDEVTFIFEVNI
                  * ****:* *.*:* **. **..***.::****** *:***:           ::****:

1406|hp|nph       NDDDLKIRVSNKLADYQTSVERWHVDTPKDTDIAEAVEGHEPPQDEPTDGG-SDPKRT
1550|chp|hut      NDDDLKIRVSNKLADFEQQVDRWHIDAPKETDASAAAEGVDVP---PEDHEWTDSDTT
12582|hp|hma      NDDDLKMRVSNKLADFEQAVDRWHVDTEKVTEAVEAAEGVDAV---ETGDE-TDAKTN
3006|hp|hhi       NDDDLKMRVSNKLADFEQAVDRWHVDTEKVTEAVEAAEGVDAT---EPGEE-TDAKTN
2306|hp|nrc1      NDDDLKSAVQDHLSSFE-ALDRWHVDTERETDVAEAAEGVDPP---KQRED-AKSTTN
2707|hp|hla       NDDELKDEVSDILADYESEIDRWHVEAEKRTKDVAAAEGVEPP---AEEGG-PDSTMT
1040|hp|hwa       NDDELKTAVSNRLTDYDDEVTRWHVDTKKQTETAEAAEGVEPP---TSTTNPPKSTNN
2800|hp|hbo       NDDDLKSKVSRRLGEYDDEVDRWHVDTEKETTTAEAAEGVEAP---PSDPD-SNFTTN
                  ***:**  *.  * .::  : ***::: . *    *.** :           ..   .