HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0062COG0436KOG0258 KOG0257arCOG01130Aspartate/tyrosine/aromatic aminotransferaseaspartate aminotransferase

HOG Organism Gene ID Name Annotation
cHOG0062 nrc1 VNG0502 aspB1 aspartate aminotransferase
cHOG0062 hmu HMUK2821 Hmuk_2821 aminotransferase class I and II
cHOG0062 hma RRNAC3495 aspB2 aspartate aminotransferase
cHOG0062 hma RRNB0206b dapB dihydrodipicolinate reductase
cHOG0062 hwa HQ2629A aspC PLP-dependent aminotransferase ( aspartate aminotransferase )
cHOG0062 hla HLAC1393 Hlac_1393 aminotransferase class I and II
cHOG0062 hbo HBOR16150 Hbor_16150 aspartate/tyrosine/aromatic aminotransferase
cHOG0062 hbo HBOR35280b Hbor_35280 aspartate/tyrosine/aromatic aminotransferase
cHOG0062 hut HUTA2538 Huta_2538 aminotransferase class I and II
cHOG0062 hvo HVO_1604 HVO_1604 Aspartate aminotransferase
cHOG0062 nph NP1666A aspC_2 PLP-dependent aminotransferase
cHOG0062 hhi 715 aspB2 aspartate aminotransferase
cHOG0062 hhi 4320 aspB6 aspartate aminotransferase
MUSCLE (3.6) multiple sequence alignment


10206|gene|hma      -------MTRVAVNGVTGQMGGAVIEAATDSEVVVGFATSD-----------TDAVDD--
502|gene|nrc1       MTEFSDRVAQVSISGIR-----AVFEAAGEDAINLGLGQPDFPTPDHARQAAVDAIESGA
1666|gene|nph       MTDFSDRVERVSISGIR-----EVFEAAGDDAINLGLGQPDFPTPDHVREAAIEAIEAGD
2538|gene|hut       MPDFSHRVEQVSISGIR-----EVFEAASEDAINLGLGQPDFPAPEHAREAAVEAIRAGD
13495|gene|hma      MTAFSRRVEQVSISGIR-----EVFEAAGEDAINLGLGQPDFPTPEHAREAAVEAIQAGK
715|gene|hhi        MTGFSRRVEQVSISGIR-----EVFEAAGEDAINLGLGQPDFPTPEHARQAAVEAIQAGE
1393|gene|hla       MPNFSDRVERISISGIR-----EVFEAAGDDAINLGLGQPDFPTPDHARQAAIDAIEAGK
2629|gene|hwa       MYSFSDRVESVSISGIR-----EVFEAAGEDAINLGLGQPDFPAPAHARDAAVEAIQAGE
16150|gene|hbo      MSEFSDRIEKVSISGIR-----EVFEAAGEDAINLGIGQPDFAAPEHARRAAIEAIKDGR
35280|gene|hbo      MSKYAPRVEKMDISGIR-----EVFEGASEDDINLGIGQPDFPTPEHIRDAALSAVEDGV
4320|gene|hhi       MSQYAARVEEMDISGIR-----EVFEAAGEDAINLGLGQPDFPTPEHAREAATSAIQNGM
                           :  : :.*:       *:*.* :. : :*:. .*            .*:    

10206|gene|hma      ---------VPVVHPAEAAAALREYDVDV----VVDFAVPKGALTVA-EACVEAGVPMVV
502|gene|nrc1       ADGYTSNRGTAALVDAIVEKHARDQGVDVAPAGVIATAGGSEALHLAMEAHVDPGDEVLF
1666|gene|nph       VDAYTSNKGTRELREAIAAKYDRDNDFAVDPENIVATSGGSEALHLAIEAHVDAGEEVIF
2538|gene|hut       ADGYTSNKGTLELREAIAAKHARDNDLDVDPGNVIATSGGSEALHIALEAHVDADEEVIY
13495|gene|hma      VDAYTSNKGTEELREAIAAKHERDNDLEVDPGDIIATSGGSEALHIALEAHVDAGQEVIF
715|gene|hhi        VDAYTSNKGTEELREAIAAKHKRDNDLDVDPGDIIATSGGSEALHIALEAHVDEGQEVIF
1393|gene|hla       ADAYTENKGTRSLREAIAEKHRTDQGIDLDPSNVIATAGGSEALHIALEAHVDAGDEVLI
2629|gene|hwa       ADAYTENKGMMSLREAIAAKHQRDQNITVNPDEIIATAGGSEALHIVMEAHIDPGDEVLV
16150|gene|hbo      ADAYTENKGIRSLREAIAAKHERDQGIERHPDDIIATAGGSEALHIAMEAHVGSGDEVII
35280|gene|hbo      VDSYTGNKGILGLREGISEKYERDSGLSVDPDNIIATSGASEALHIAIEAHVRNGGEVII
4320|gene|hhi       GDSYTSNKGIPELREAISERYATDNGQDIPPENIIATAGASEAIHVAIEAHVQPGDEVLC
                                :  .       : .       ::  :  . *: :. ** :  .  :: 

10206|gene|hma      GTTGF-DEDGLARLQDASEEIPLLKATNFSQGIQVLQRLISEAVGTLDDYDLELMETHHN
502|gene|nrc1       PDPGFVSYDALTRMAGGN-PVGLPLRDDLTLAPETVEDHIT------DDTAAFVVNSPAN
1666|gene|nph       PDPGFVSYDALTHIAGGE-PNPVSLRDDLTLSPADVEAAIT------DDTAMFVVNSPAN
2538|gene|hut       PDPGFVSYEALTHLAGGT-PRPVELRDDLTLDPADVEAAIT------DDTAAFVVNSPAN
13495|gene|hma      PDPGFVSYDALTHLAGGT-PRPVPLREDLTMAPETVEEAIT------DDTAAFVVNSPAN
715|gene|hhi        PDPGFVSYDALTHLAGGT-PRPVPLREDLTMAPETVEEAIT------DDTAAFVVNSPAN
1393|gene|hla       PDPGFVSYDALTKLTGGE-PVPVPLRDDLTIDPAAIEAAIT------DDTVAFVVNSPGN
2629|gene|hwa       PDPGFVSYDALTRLAGGT-PVPVPLRDDLTLDPAAIEERIT------ADTAAFVVNSPGN
16150|gene|hbo      PDPGFVSYDALTKLADGT-PVPVPLRDDLTLDPAAVEEAIT------DDTAAFIVNSPGN
35280|gene|hbo      PDPGFVAYEQLAVLAGGT-PKPVELRDDLTLDPATVEDAIT------EDTDLFIVNSPAN
4320|gene|hhi       PDPGFLAYEQLVLLAGGE-PKRVELRDDLTLDPAAVENAIT------DNTSLFIVNSPAN
                      .**   : *. : ..     :    :::     ::  *:       :    ::::  *

10206|gene|hma      RKVDAPSGTASSILDV-----IQEERDV----EPVYG-----REGHAPREDDEIG-----
502|gene|nrc1       -----PTGAVQSPADMRAFARIADEHDVLCISDEVYEHIVFEGEHRSPMEFADTDNVVVV
1666|gene|nph       -----PTGAVQSEADMREFARIAADHDVVCLSDEVYEPFVFDGVHRSPAAFDETGNVVVV
2538|gene|hut       -----PTGAVQSPADMREFARIADEHDVLCISDEVYEHIVFEGEHRSPAEFAESDNVVVI
13495|gene|hma      -----PTGAVQSPEDMREFARIADEHDVLCISDEVYEHQVFEGEHRSPAEFSETGNVVIV
715|gene|hhi        -----PTGAVQSPEDMRAFARIADEHDVLCISDEVYEHQVFEGEHRSPAEFSDTGNVVVV
1393|gene|hla       -----PTGAVSSEEDVREFARIADEHDVLCISDEVYEYTVFEGEHYSPMEFTETDNVVVI
2629|gene|hwa       -----PTGAVSSQTDIREFARIADEYDVFCISDEVYEYTVFDGEFHSPLAFADRDNVVVV
16150|gene|hbo      -----PTGAVSPPEDIREFARIADEHDVLCISDEVYEYTVFDGEFRSPAEFAETDNVVVV
35280|gene|hbo      -----PTGAVQTESDMREFARIADEYDVVCLLDEVYEHIVFEGEHRSPMEFATTDNVVQV
4320|gene|hhi       -----PTGAVQSKRDMAEFARLADEHEVICLSDEVYEKIVFDGEHHSPAEFASSDRVIQA
                         *:*:...  *:     :  : :*    : **          :*      .     

10206|gene|hma      --------VFARRAGDVRGEH-------------------------ELVLAGNDEVLS--
502|gene|nrc1       NACSKTYSMTGWRLGWVAASERRAERMLRVHQYVQACASAPAQYAAEAALSGPQGVVDEM
1666|gene|nph       NAASKAYSMTGWRLGWVTGTSERIDRMLRVHQYAQACASAPAQYAAEAALSGPQEPVEEM
2538|gene|hut       NAASKAYSMTGWRLGWVTGSDERIERMLRVHQYGQACASAPAQYAAEAALSGPQDRVGEM
13495|gene|hma      NACSKAYSMTGWRLGWVTGATDRIERMLRVHQYAQACASAPAQYAAEAALTGPQEPVAEM
715|gene|hhi        NACSKAYSMTGWRLGWVTGATDRIERMLRVHQYAQACASAPAQYAAEAALSGPQDQVSEM
1393|gene|hla       NSASKLFSMTGWRLGWVYGSEERVERMLRVHQYAQACASAPAQYAAEAALRGDHGVVDEM
2629|gene|hwa       NSASKLYSMTGWRLGWVLGSTSRVERMLRVHQYTQACAAAPSQFAAEAALTGPQDVITEM
16150|gene|hbo      NSASKLYSMTGWRLGWVHGSSRRIERMVRAHQYVQACASAPAQFAAEAALTGPQGIVDEM
35280|gene|hbo      NACSKSYSMTGWRLGWVTASDDRIERMLRVHQYVQACASAPAQYAAEAALKGPQEPVEEM
4320|gene|hhi       SACSKTYSMTGWRLGWVAASSERIERMLRVHQYVQACASAPSQYAAEAALTGPQEPVREM
                            : ..* * * .                           * .* *    :   

10206|gene|hma      LSHRAEDRGVFAAGALDAATWLVGRDSGWYEFGDVVDA----------------------
502|gene|nrc1       VAAFEARRDVLLDGLEAMGLDVPTPGGAFYAMPTVPDGWIDEVVDRGVVVVPGSAFGDHG
1666|gene|nph       RSAFETRRDVLVDGLEDMGLSVPTPKGAFYAMPEVPDGWTDEVIDRGVVVVPGEAFGDAG
2538|gene|hut       VDAFEERRNVLLDGLEDMGLQTPTPKGAFYAMPEVPEGWVEEVIDRGVVVVPGAAFGDGG
13495|gene|hma      REAFKERRDVLLDGLNEMGLDCPTPKGAFYAMPKVPDGWVDEVIDRGVVVVPGDAFGEHG
715|gene|hhi        RDAFQERRDVLLDGLDEMGLDCPTPKGAFYAMPKVPDGWVDEVIDRGVVVVPGDAFGEHG
1393|gene|hla       TASFERRRDLLLDGFDEIGIDCPTPQGAFYAMPRVPEGFVDECLDRGVVVVPGEAFGEHG
2629|gene|hwa       TDSFERRRDLIVDGLTDIGLEVPTPRGAFYCMPKVPDGFVMECLERGVIIVPGDAFGANG
16150|gene|hbo      TDSFQRRRDIVVDGLEDIGLTVPTPKGAFYAMPEVPDGFVDECLERGVIVVPGEAFGANG
35280|gene|hbo      VSAFETRRDVLLDGLDDIGLETPRPEGAFYAMPSVPEGWASEVLDNGVIVVPGDVFGERG
4320|gene|hhi       VSAFEERRNVLLDGLEDIGLDTPVPKGAFYAMPHVPDGWTQKMLDNDVIVVPGEAFGPSG
                           *.:.  *    .       ..:* :  * :.                      

10206|gene|hma      ------------------------------
502|gene|nrc1       AGTARISYATDMATLRDAIDVMRAATAAVQ
1666|gene|nph       AGHARISYAVDVETLKDALEVMGEATAALR
2538|gene|hut       EGYARISYATDMEQLKEAIDVMSAATAAVR
13495|gene|hma      AGYARISYATDMETLEEAIDIMADATAALR
715|gene|hhi        AGYARISYATDMETLKEAIDIMADATAAVR
1393|gene|hla       RGHARISYATDESELREALDVMADAYEAAK
2629|gene|hwa       SGYARLSYATDEESLREALDIMQQAYTAVS
16150|gene|hbo      DGYARLSYATDEASLHEALDIMAEAYDAVV
35280|gene|hbo      AGYARISYATNVETLKEALEVMKSVTRSF-
4320|gene|hhi       EGQARISYATSTAELKEALEVMGTVTDSL-