HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0615COG3363arCOG04727Archaeal IMP cyclohydrolasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0615 nrc1 VNG2371 vng2371 no entry
cHOG0615 hmu HMUK0907 Hmuk_0907 IMP cyclohydrolase( EC:3.5.4.10 )
cHOG0615 hma RRNAC2659 IMP cyclohydrolase
cHOG0615 hwa HQ1006A purH IMP cyclohydrolase
cHOG0615 hla HLAC2704 Hlac_2704 IMP cyclohydrolase
cHOG0615 hbo HBOR02200 Hbor_02200 IMP cyclohydrolase( EC:3.5.4.10 )
cHOG0615 hut HUTA1038 Huta_1038 IMP cyclohydrolase
cHOG0615 hvo HVO_0011 HVO_0011 purO IMP cyclohydrolase
cHOG0615 nph NP0732A purO IMP cyclohydrolase
cHOG0615 hhi 3068 purO IMP cyclohydrolase
MUSCLE (3.6) multiple sequence alignment


1006|gene|hwa       MYLGRFIIIGETTAVYRVSSRSYPNRQIISRDNMLTVVPTSEAAQTNNPYVSYNCMRQG-
2371|chp|nrc1       MYIGRFVVVGPSVAAYRVSSRSFPNRKLIERPAGLTVVPTADAEETTNPYVSYNCVRTA-
732|gene|nph        MYVGRFIVVAPDRAAYRVSSRSFPNRRIVDRDGTLTVGPTEDAPETDNPYISYNCLRTV-
2200|gene|hbo       MYVGRFIVIGPDFGAYRVSSRSFPNRQVVERDGTLTVAPTPDAPETDNPYISYNCVREG-
2704|gene|hla       MYVGRFVVVAPGIGAYRVSSRSFPNRRVTDRDGRLTVGPTPDAPETDNPYVSYNCARAVR
1038|gene|hut       MYVGRFVVVAPEVGAYRVSSRSFPNRKAVDRDGTITVAPTADAPETDNPYISYNAVRLT-
12659|gene|hma      MYVGRFVVVSPEVGAYRVSSRSFPNRQAVQRDGTVTVEPTPDAPETDNPYISYNGVRVT-
3068|gene|hhi       MYVGRFVVVSPEVGAYRVSSRSFPNRQAVQRDGTVTVEPTPDAPETDNPYISYNGVRVT-
                    **:***:::.   ..*******:***.  .*   :** ** :* :* ***:***  *   

1006|gene|hwa       ----GEKIVIGNGSHVDPIAEKIDRGYPARDALAEALLALDYEKDDYNTPRIAGIVGSS-
2371|chp|nrc1       ----GGHAVVGNGSHVDPITEKVERGYPPRDALTEALLAMDYEKDDYDTPRIAGVLAPDG
732|gene|nph        ---GDDYAVVGNGTQVDPIAEKLSLGYPPRDALAESLLALDYEKDDYDTPRIAGVVGDE-
2200|gene|hbo       ----GDSVVVGNGSHVDPIAEKLDLGYPARDALAESLLAMDYEKDDYDTPRIAGVVGEE-
2704|gene|hla       TPTDEPLAVVGNGSHVDPIAEKLELGYPARDALATPLLALDFEKDDYDTPRIAGVVGAET
1038|gene|hut       ----DRGAVIGNGSHVDPIAEKLALGTPARDALAEPLKALDFEKDDYDTPRIAGIVGVSE
12659|gene|hma      ----ERGAVVGNGSHVDPIAEKLELGYPARDAIAEPLLSLDFEKDDYDTPRVAGIVGVDA
3068|gene|hhi       ----ERGAVIGNGSHVDPIAEKLELGYPARDAIAEPLLSLDFEKDDYDTPRVAGIVGVDG
                            *:***::****:**:  * *.***:: .* ::*:*****:***:**::. . 

1006|gene|hwa       -----------SYVGIIRQDAVIIRSISE-PTLVSTYENDAPTTAQLSLKG-----DIEE
2371|chp|nrc1       T----------AYVGIVRADAVLVRAVEE-PTLVATYEKDAPEAIGF-DAA-----TAAD
732|gene|nph        -----------SYIGTVRRDALIVEAVEE-PTLVATYEKSEPEPTSL-GAD-----DPSE
2200|gene|hbo       -----------SYIGIVRRDALLVRPVTENPMLVATYEEDDPAVVVFDGDG-----SPAE
2704|gene|hla       -----------ATIGVVRRDGLVVEAVDE-PTIVATYETDSPEPYAL-AAADAETPDAAA
1038|gene|hut       DDPT--AGEAGAAIGIVRRDALVVEAVEE-PTLVATYERDDPVPFDL-GAN-----DAAG
12659|gene|hma      ADPTTNADGPGAVIGTVRRDALLVEEVTE-PTLVATYEENSPTAFDL-AAT-----DASD
3068|gene|hhi       ADPTTNADGPGAVIGTVRRDALLVEEVTE-PTLVATYEEDSPTAFDL-AAT-----DASD
                               : :* :* *.:::  : * * :*:*** . *    :             

1006|gene|hwa       IAQKAYELEYEHPVCAAAVTHQGQGESGDIVAQIYNGK-
2371|chp|nrc1       AAREAYSAAFEHAVCAAGVSRRGVGDGYDTA--VVNDP-
732|gene|nph        LAAELYDRDLEHPVCAAGVV--ADGDSFEVG--YYNGE-
2200|gene|hbo       LAERAYEMDYEHAVCAAGVT--YDDGDVDVG--FYNDE-
2704|gene|hla       AATEVLGADFEHPVCAAGAT--VDADGATLA--FDNDAE
1038|gene|hut       AARELYDHEFEHAVCAAGVS--GSAGDYETA--IVNE--
12659|gene|hma      VAREVYDHEYEHAVCSAGVA--GSAGEFDVA--VYNGE-
3068|gene|hhi       VAREVYDHEYEHAVCSAGVA--GSAGEFDVA--VYNGE-
                     *        **.**:*..                *