HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0614COG0258KOG2520 KOG2518 KOG2519arCOG040505'-3' exonuclease (including N-terminal domain of PolI)endonuclease.putative excision repair protein

HOG Organism Gene ID Name Annotation
cHOG0614 nrc1 VNG1359 rad2 endonuclease.putative excision repair protein
cHOG0614 hmu HMUK2779 Hmuk_2779 XPG I domain protein( EC:3.- )
cHOG0614 hma RRNAC0032 rad2 flap endonuclease-1
cHOG0614 hwa HQ2418A rad2 flap endonuclease-1
cHOG0614 hla HLAC1613 Hlac_1613 XPG I domain protein
cHOG0614 hbo HBOR13850 Hbor_13850 flap endonuclease 1( EC:3.- )
cHOG0614 hut HUTA2512 Huta_2512 XPG I domain protein
cHOG0614 hvo HVO_2873 HVO_2873 rad2 Rad2/XPG flap structure-specific endonuclease
cHOG0614 nph NP3784A fen flap endonuclease-1
cHOG0614 hhi 793 HAH_0793 flap endonuclease-1
MUSCLE (3.6) multiple sequence alignment


1359|gene|nrc1      MGNADLRQLAAIEETPFADLEGSVVAVDAHNWLYKYLTTTVQWTGADVYTTSDGTEVANL
1613|gene|hla       MGNADLRDLAAIRDISFAEIEGSVVAVDAHNWLYRYLTTTVKWTADETYTTTDGVEVANL
2512|gene|hut       MGNADLRDIAVIEDVSFDVLEGSVVAVDAHNWLYRYLTTTVKWTNDDIYTTADGTEVANL
3784|gene|nph       MGNADLRTLAAIEPKPFDELGGSVVAVDAHNWLYRYLTTTVKFTRSEAYTTADGEEVANL
10032|gene|hma      MGNADLRSLAALSDVSFDDLGGSVVAVDAHNWLYRYLTTTVKFTSESKYTTSNGEEVANL
793|gene|hhi        MGNADLRSLAALSDVSFGDLGGSVVAVDAHNWLYRYLTTTVKFTSESKYTTSDGEEVANL
2418|gene|hwa       MGNAALRQLAALESVAFDDISGSVIAVDAHNWLYRYLTTTVKFTSDAAYTTESGVEVANL
13850|gene|hbo      MGNADLRSLASLSEVSFDDLAGGVVAVDAHNWLYRYLTTTVKFTGDEVYTTTEGEEVANL
                    **** ** :* :   .*  : *.*:*********.******::*    *** .* *****

1359|gene|nrc1      VGAVQGLPKFFEHGLTPVFVWDGGVTELKDDEIADRREQRERYEEQLDDAREA--GDAAE
1613|gene|hla       IGIVQGLPKFFEHDLIPVMVFDGAVTELKADEVADRREKREQAEERRVAAKER--GDAVE
2512|gene|hut       VGVVQGLPKFFEADVTPVFVFDGAVTDLKDDEVQRRREQREQYEDQLEDAREA--GDAVR
3784|gene|nph       IGVVQGLPKFFEHDVTPVFVFDGGVSDLKADEVEKRRDQRERYEAQLEAAKERDETDAAE
10032|gene|hma      IGVVQGLPKFFEHDMTPVFVFDGAVTDLKDDEVEKRREQRQKYESELEAAREA--GDSTR
793|gene|hhi        IGVIQGLPKFFEHDLTPVFVFDGAVTDLKDDEVEKRREQREKYESELEAAREA--GDSTR
2418|gene|hwa       IGVVQGLPKFFEHDLTPVFVFDGGVTELKDEEVQERRVAREEAVELQAAAEER--GDELA
13850|gene|hbo      IGIVQGLPKFFEHDLTPVFVFDGGVTELKDAEVSERRAQREKAEELKKEAEER--GDDME
                    :* :******** .: **:*:**.*::**  *:  **  *:        * *    *   

1359|gene|nrc1      AARLDARTQRLTPTIHETTRELFDLLDIPQVEAPAEGEAQAAYMTRTDDAVDYAGSDDYD
1613|gene|hla       AARLEARTQRLTDTIQETTRELLRLLDVPIVEAPAEGEAQCAHMAATGT-VDHAGSEDYD
2512|gene|hut       VARLESRTQRLTDVILETTRELLALLDVPTVDAPAEGEAQAAHMARRGD-VDYVGTEDYD
3784|gene|nph       IAALESRTQRLTDTIVETTRELLARLDVPVVEAPAEGEAQAAHMARRGD-ADYVGSEDYD
10032|gene|hma      VAKLDSRTQRLTDTIVDTTRDLLELLDVPIVDAPAEGEGQASVMARRGD-VDYVGTEDYD
793|gene|hhi        VAKLDSRTQRLTDTIVDTTRDLLELLDVPIVDAPAEGEGQASVMARRGD-VDYVGTEDYD
2418|gene|hwa       ASRLEARTQRLTETIHETTRGLLNRLDVPIIEAPAEGEAQAAEMAIRGD-VDYVGSEDYD
13850|gene|hbo      AARLEARTQRLTDVIHETSRGLLERLDVPVIEAPAEGEAQASYMAKQGD-VDYVGSEDYD
                     : *::****** .* :*:* *:  **:* ::******.*.: *:  .  .*:.*::***

1359|gene|nrc1      CLLLGSPVTLRQLTSSGHPELMDFDATLAEHDLTWEQLVDVGILCGTDFNPGIDGFGPTT
1613|gene|hla       TLLFGAPTTLRQLTSKGDPELMDLAATLDDLGFDRQGLVDAAMLCGTDFNEGVRGIGPKT
2512|gene|hut       ALLFGAPFTLRQLTSSGDPELMDFEATLAEHDLSWEQLVDVALLCGTDFNDGVRGYGPKT
3784|gene|nph       ALLLGAPYTLRGLTSNGDPECMDFEATLSTHDLSWEGLVDAAILMGTDFNEGLSGVGPKT
10032|gene|hma      ALLFGAPMTLRQITSKGDPELMDFAATLEHHDLTWEQLVDAAILMGTDFNEGISGIGPKT
793|gene|hhi        ALLFGAPMTLRQITSKGDPELMDFEATLEQHDLTWEQLVDAAILMGTDFNEGISGIGPKT
2418|gene|hwa       TLLFGAPYTVRQLTSKGDPELMDLQTTLKNQNLTREQLVDVAILCGTDFNDGISGIGPAT
13850|gene|hbo      TLLLGAPYTLRQLTSKGDPELMDLEATLSDLDVTQEQLIDIAILCGTDFNEGISGVGPKT
                     **:*:* *:* :**.* ** **: :**   .. .: *:* .:* ***** *: * ** *

1359|gene|nrc1      ALDAIGEHGDLWDVLAAEGEHVAHGDRIRELFLNPDVTDDYVIDPDVSPAIDAARAFVTD
1613|gene|hla       AVKAVREHGDLWGVLDARGVEIPNAEAIRELFMDPPAT-DVDVDTAVNPDVDAAREYVVD
2512|gene|hut       AVKAVREHGDLWGVSENEDVYVENADRIRELFLDPAVTEEYTIETSIDPDLAAAREFVTD
3784|gene|nph       AVKLIHEHGDLRSVLAARDDDIPHADRIRELFLDPAVTDDYDYDTDIDPDFERAREFVTE
10032|gene|hma      AVKDLHEHGDLYTVLAARGEHIDHADRIRDLFLDPAATDDYEIPDSIEPDIDAARTFVTD
793|gene|hhi        AVTELHEHGDLYAVLEARDEHIDHADRIRNLFLDPEVTDDYEIPDSIEPDVDAARAFVTD
2418|gene|hwa       AISAINDHGDLWSVLDARDEFIQHADRVRSLFLDPPVTNEYTLHTTINPDMDAARSYVVD
13850|gene|hbo      ALKEVKEHGDLWTVLEARDDYIENADRVRELFRDPPVTDDYEFDTDLSPDLDAARAYVSE
                    *:  : :****  *    .  : :.: :*.** :* .* :      :.* .  ** :* :

1359|gene|nrc1      EWEVDADAVARGFERIDAAAAQTGLDRWT
1613|gene|hla       EWGVAADEVERGFERIAESQVQTGLDRWT
2512|gene|hut       QWAVDAEEVARGFERIESSVVQTGLEDWT
3784|gene|nph       TWGVPADEVERGFERIEESVIQTGLDRWT
10032|gene|hma      QWEVDADEVARGFERIDDSVVQTGLDRWA
793|gene|hhi        KWEVDADEVARGFERIDESVVQTGLDRWA
2418|gene|hwa       DWEVPADEVERGFERIETSVVQTGLDEWI
13850|gene|hbo      EWEVPADEVARGFERIEDSLVQTGLDQWT
                     * * *: * ******  :  ****: *