HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0613COG1202arCOG00554/2Superfamily II helicase archaea-specificDNA repair protein

HOG Organism Gene ID Name Annotation
cHOG0613 nrc1 VNG2173 rad24a DNA repair protein
cHOG0613 hmu HMUK1035 Hmuk_1035 DEAD/DEAH box helicase domain protein( EC:3.6.1.- )
cHOG0613 hma RRNAC2756 rad24a rad24a/uvrB domain-containing protein
cHOG0613 hwa HQ3065A superfamily II helicase
cHOG0613 hla HLAC0056 Hlac_56 DEAD/DEAH box helicase domain protein
cHOG0613 hbo HBOR28920 Hbor_28920 DNA/RNA helicase, superfamily II( EC:3.6.1.- )
cHOG0613 hut HUTA1952 Huta_1952 DEAD/DEAH box helicase domain protein
cHOG0613 hvo HVO_0283 HVO_0283 AshA putative helicase AshA
cHOG0613 nph NP5144A helicase
cHOG0613 hhi 43 HAH_0043 rad24a/uvrB domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2173|gene|nrc1      ------------------------------------------------------------
56|gene|hla         MSQQLAEVETLFLHEARSDYTVVATRDGNRILRGRLELKETSAGPRPGKFRVIRDGEDHP
3065|gene|hwa       MSRQVSRVDTLFLHERGEDFAVVVRRDGGRVFQGTLELKQTSAGPRPAKFRVKRGDSEEP
28920|gene|hbo      MSKQVGRIDTLFVHETNDDYLVVVQRDGERVFRAVLELQETNAGPRPAKFRVKRGSNEEP
5144|gene|nph       MSKQVADVGTLFLHETDGEYAVVARRDGERLFRGRLELKETSAGPRPGRFRVKDGDDDVP
1952|gene|hut       MSQQVTQVDTLFLHEDGEDFQVVVQRDGERVLDGRLEVKETEAGPRPARLRIKRGSQEDL
12756|gene|hma      ------------------------------------------------------------
43|gene|hhi         MSQQAAQVETLFLHEHGEEFRVAAHRDGERLFHGILELKETDAGPRPRRLRVKDGTSEEL
                                                                                

2173|gene|nrc1      --------------------------------MLDAYQLAAKVVRTCRYCAGRGRYSPLT
56|gene|hla         RQPGEFVDLARAAGRIRISEQTSPKNRKRLQAMLDGYQLEAMAVRTCRRCANDGRYGPIT
3065|gene|hwa       QDPSSFVDIAREASRIRISQQTSPPNRTALSELLDGYQLDALVVRTCRYCASNGRYSPIT
28920|gene|hbo      RDPSQFVELARRAERIRISQQTSKARRDEFREMLDGYQLDALVVRTCRYCASNGRYSPIT
5144|gene|nph       RRPEQFVELARRATRIRISEQTSRAGRAELEAMLDGYQLDAKQVRTCRYCAGNGRYSPLT
1952|gene|hut       RSPDQFVELARRAGRIRVSEQTSARGRRVVRELLDAYQLEAKVVRTCRFCASAGKYSPIT
12756|gene|hma      --------------------------------MLDAYQVEAKVVRTCRLCASDGRYSPIT
43|gene|hhi         RSPDQFVDLARRAARIRISEQTAPRARERIREMLDAYQIEAKVARTCRLCASDGRYSPIT
                                                    :**.**: *  .**** **. *.*.*:*

2173|gene|nrc1      AETAIEADGEFICRDCAVEELERELSFS---GAVSGAAQDRLEELLFAEQDLEKVTGLLG
56|gene|hla         SDGAIEHNDELICRDCARRELERELSYK---GEFTGAAEERLEELLYESGDLDRIVNLLQ
3065|gene|hwa       DETAIATDREYICPDCAKRELERELDFSTGTGRLTGAAQQRLEELLIETQDLDRITDLLS
28920|gene|hbo      EDTAIKADNEYICPDCAKRELERELDFS-GTGAMTQAAQERLESLLLETQDLGRISNLLK
5144|gene|nph       SETAIEADNEHICPDCAKRELEREANYR---GLRSG-ARDRLEELLVEVGDLESVINLLS
1952|gene|hut       SETAIDADGEDICPSCAITELERELAYH---GDVTGTARDRLEELLLDVQDLERIVNLLS
12756|gene|hma      SETAIETDDETICPECARQQLDRELAFK---GSISGDARDRLEELLLEVQDLDRVTNLLS
43|gene|hhi         SETAIETDDETICPECARQQLDRELAYK---GNIGGDARDRLEELLLEVQDLDRVTNLLS
                     : **  : * ** .**  :*:**  :    *     * :***.**    **  : .** 

2173|gene|nrc1      GELDPDLTKYDEVSATTDDVDPVAVSELDLHPDVQGLFEDRFEELLPVQSLAVENGLVEG
56|gene|hla         GGLDPDLTKYDEVSANVDDISPVRTEDLDLHPDLSAHLQGRFEELLPVQSLSVRNGLLDG
3065|gene|hwa       GGLDPDLTRFDTVSATTDEVDLVETTTLDLHPKLQELLEARFDTLLPVQSLAVNNGLFDG
28920|gene|hbo      GGLDPDLTKFDTVSATTDDIDLVSTSTLDLHPALQSMVENRFETLLPVQSLAVENGLFDE
5144|gene|nph       GDLDPELTKFDEISATTDDIDLVSTDTLDVHPKLQSHIQ--FDELLPVQSLAVENGLLEG
1952|gene|hut       GELDPELTKFDEISATVEDIDLVPTDSLSLHPGMQQKLEGQFDELLPVQSLAVENGVTDG
12756|gene|hma      GQLDPDLTKFDEISATVDEVDPVRVDSLDLHPGMQEHLESRFDTLLPVQSLAVEHGATEG
43|gene|hhi         GQLDPDLTKFDEISATVDEVDPVRVDSLDLHPGMQEHLESRFDTLLPVQSLAVEHGATEG
                    * ***:**.:* :**..:::. * .  *.:** :.  .:  *: *******:* :*  : 

2173|gene|nrc1      DDQMVVSATATGKTLVGEIAGLHRLQSGNGKLLFLVPLVALANQKHEDFQDEYGHLANVT
56|gene|hla         TDQLVVSATATGKTLVGELAGIDRALKGDGKLLFLVPLVALANQKHEDFKDRYGDRLNVS
3065|gene|hwa       HDQLVVSATATGKTLIGELAGVNRVLTEGGKLLFLVPLVALANQKHEDFTERYGDLIDVT
28920|gene|hbo      RDQLVVSATATGKTLVGELAGVNRALNGDGKMLFLVPLVALANQKHEDFEERYGDHLNVT
5144|gene|nph       RDQLVVSATATGKTLVGELAGIDRALSGDGKLLFLVPLVALANQKHEDFEEDYGDILDIT
1952|gene|hut       QDQLVVSATATGKTLIGEMAGIDRVLNGKGKMLFLVPLVALANQKYQDFQAEYGDIADVS
12756|gene|hma      RDQLVVSATATGKTLIGEMAGIDRVLNNKGTMLFLVPLVALANQKYEQFQDRYGDMVDVS
43|gene|hhi         RDQLVVSATATGKTLIGEMAGIDRVLNNKGTMLFLVPLVALANQKYEQFQDRYGDMVDVS
                     **:***********:**:**: *  .  *.:*************:::*   **   :::

2173|gene|nrc1      IRVGSSRIRDDGHAFDPAADIIVGTYEGIDHALRTGRDLGDIGTVVIDEVHTLKEDDRGH
56|gene|hla         IRVGSSRVNDDGNRFDPNADVIVGTYEGIDHALRTGKDLGDIGTVVIDEVHTLKEGERGH
3065|gene|hwa       IRVGASRIADDTNRFDPDADIIVGTYEGIDHALRTDKDLGDIGTIVIDEVHTLKEGERGH
28920|gene|hbo      IRVGASRINDDGNRFDPNADIIVGTYEGIDHALRTGKDLGDIATVVIDEVHTLKEGERGH
5144|gene|nph       LRVGASRIRDDGNRFDPGADVIVGTYEGIDHALRTGKDLGDIGTVVIDEVHNLGADERGH
1952|gene|hut       LRVGSSRIRGDGGGFDPSADIIVGTYEGIDHALRVGHDLGDIGTVVIDEVHTLGEGERGH
12756|gene|hma      LRVGASRIADEGGRFDPEADVIVGTYEGIDHALRTGKDLGTVGTVVIDEVHTLGEDERGH
43|gene|hhi         LRVGASRIADEGGRFDPEADVIVGTYEGIDHALRTGKDLGTVGTVVIDEVHTLGEDERGH
                    :***:**: .:   *** **:*************...*** :.*:******.*  .:***

2173|gene|nrc1      RLDGLISRLKYYCEQRREE---------------RAGYDGAQWVYLSATVGNPGELAGKL
56|gene|hla         RLDGLISRLKYYSENRMET---------------HEGYGGTQFVYLSATVGNPEWLAEKL
3065|gene|hwa       RLDGLISRLKYYCATRANH---------------RRGYDGAQSIYLSATVGNPETLAERL
28920|gene|hbo      RLDGMISRLKHYCETREKQ---------------RNSYDGAQWVYLSATVGNPEMLAQKL
5144|gene|nph       RLDGLVSRLKHYC---------------------RTNQCDTQWVYLSATVGNAGSLAESL
1952|gene|hut       RLDGLISRLKYYCESGGKTAARSNRSGGRGGSASSSQSGDTQWIYLSATVGNPGSLADSL
12756|gene|hma      RLDGLISRLKYYCESGG-----------------APDSGDTQWIYLSATVGNPGQLADQL
43|gene|hhi         RLDGLISRLKYYCESGG-----------------APDSGDTQWIYLSATVGNPGQLADQL
                    ****::****:*.                          .:* :********.  **  *

2173|gene|nrc1      RANLVEFEERPVPIERHVTFADGAEKPDIENTLVRREFDQESSMGYRGQTIIFTNSRRRC
56|gene|hla         RATLIEYEERPVPIERHVTFADSREKAQIADKLVKREFDTKSSKGYRGQTIIFTNSRRRC
3065|gene|hwa       QTTLIEFEERPIPIDRHVTFADGREKVDITNKLVRREFDTKSSKGYRGQTIVFTNSRRRC
28920|gene|hbo      RATLIEFEERPVPIERHVTFADGREKPDIINKLVRREFDTKSSKGYRGQTIVFTNSRRRC
5144|gene|nph       GAQLIEFEERPVPIERHVTFADDREKLDIEDKLVKRAFDTKSSKGYRGQTIVFTNSRRRC
1952|gene|hut       SAKLIEFEERPVPIERHVTFADDYEKVDIENKLAKRAFDTKSSKGYRGQTIIFTNSRRRC
12756|gene|hma      RATLIEFEERPVPIERHVTFADGREKIETEKKLVKRAFDNKSSKGYRGQTIIFTNSRRRC
43|gene|hhi         RATLIEFEERPVPIERHVTFADGREKIETEKKLVKRAFDNKSSKGYRGQTIIFTNSRRRC
                     : *:*:****:**:*******. ** :  ..*..* ** :** *******:********

2173|gene|nrc1      NEISRKLDYPSRPYHAGLDYGERKSVERQFGDQDLAAVVTTAALAAGVDFPANQVIFDTL
56|gene|hla         HEISRKLRYDSAPYHAGLDYKRRKKVERQFGNQDLSAVVTTAALAAGVDFPASQVIFDSL
3065|gene|hwa       HEISRKLSYSSAPYHAGLDYNQRKRVERDFGNQDLAAVVTTAALAAGVDFPASQVVFDSL
28920|gene|hbo      HEIARKLEYDAAPYHAGLDYGRRKKVERMFGNQDLAAVVTTAALAAGVDFPASQVVFDTL
5144|gene|nph       HEISRQLAYDSAAYHAGLDYGERKRVERQFGNQDLAAVVTTAALAAGVDFPASQVIFDSL
1952|gene|hut       HEISRRLEYSSAPYHAGLDNKRRGEVESLFADQELAAVVTTAALAAGVDFPASQVIFDSL
12756|gene|hma      HQISRKLEYSSAPYHAGLDNRKRQRVERQFADQDLAAVVTTAALAAGVDFPASQVIFDSL
43|gene|hhi         HQISRKLEYSSAPYHAGLDNRKRQRVERQFADQELAAVVTTAALAAGVDFPASQVIFDSL
                    ::*:*.* * : .******   *  **  *.:*:*:****************.**:**:*

2173|gene|nrc1      AMGIEWLSVQEFEQMLGRAGRPDYHDRGKVYVLVEPDASYHSSMEGTEEEIAFTLLKGDM
56|gene|hla         AMGIEWLSVQEFSQMLGRAGRPDYHDRGRVYLLVEPDGVYHNSMDRTEDEVAFTLLKGEM
3065|gene|hwa       AMGIEWLSVQEFEQMLGRAGRPDYHDEGTVYLLVEPDGAYHNSMDRTEDEVAFTLLKGEM
28920|gene|hbo      AMGIEWLSVQEFEQMLGRAGRPDYHDKGTVYLLVEPDCSYHNSMEMTEDEVAFKLLKGEM
5144|gene|nph       AMGIEWLSVQEFEQMLGRAGRPDYHDKGTVYLLVEPDGAYHNSMEMTEDEVAFKLLKGEM
1952|gene|hut       AMGIEWLTVQEFSQMLGRAGRPDYHDKGTVYLLVEPDGVYHNSQEMTEDEVAFKLLKGEM
12756|gene|hma      AMGIEWLTVQEFSQMLGRAGRPDYHDKGTVYMLVEPDCSYHNSMEMTEDEVAFKLLKGEM
43|gene|hhi         AMGIEWLTVQEFSQMLGRAGRPDYHDKGTVYMLVEPDCTYHNSMEMTEDEVAFKLLKGEM
                    *******:****.************* * **:*****  **.* : **:*:**.****:*

2173|gene|nrc1      ENVVTHYDEDAAVEETLANVTVGGTAAKRLNDRMVGDIPTKHALGKLLEYEFIDGLEPTD
56|gene|hla         EDVATHYDETAAVEETLANVVVAGKKAKRLNDRMIGEVPTKHAVGKLLEWKFIDGFSPTP
3065|gene|hwa       EDVMTIYDESAAAEETLANVVVAGKYAKQLNERMIGEVPTKRAVGKLLEWEFIDGLTPTP
28920|gene|hbo      EDVMTVYDESAAAEETLANVIVAGKKAKRLNDRMIGDVPTKHAVGKLLEWEFIDGFDPTP
5144|gene|nph       EPVVTRYDETAAIEETLANVVVAGKAAKRLNERMVGDVPTKHAVGKLLKYEFIDGLEPTP
1952|gene|hut       EPVTNRYDESAAVEETLANIVVGGSAAKRLNDRMLGEVPTKHAIGKLLEYEFIDGLEPTP
12756|gene|hma      EPVITRYDEGAAVEETLANVTVAGKQAKRLNDRMVGEVPTKHALGKLLEYEFIDGLSPTP
43|gene|hhi         EPVITRYDEGAAVEETLANVTVAGKQAKRLNDRMVGEVPTKHALGKLLEYEFIDGLSPTP
                    * * . *** ** ******: *.*. **.**:**:*::***.*:****:::****: ** 

2173|gene|nrc1      RGRAVTTHFLDPDSAFRILDGVRKGHAPGRIIATLELREDDQ
56|gene|hla         LGRGITRHFLAPDEAFFMLDAIRKGTDPYQIVADLELRDDEE
3065|gene|hwa       LGRAVCRHFLSPQDAFMLLDQIRNNVDPYEIIATMELEDNE-
28920|gene|hbo      LGQAVCRHFLAPKDAFRILDGIRQGLSPYELVAEMELAEDDL
5144|gene|nph       LGQAITEHFLKPDEAFVLLDAIRKGTPPYELVAEIELRGEE-
1952|gene|hut       LGRAVTRHFLSPDRAFLLLDGIRKGRDPFDIVAEVEFADEEL
12756|gene|hma      LGRAVTRHFLAPDESFQLLDGIRKGQHPYEIVADMELRDEH-
43|gene|hhi         LGRAVTRHFLAPDESFQLLDGIRKGQHPYEIVADMELRDEH-
                     *..:  *** *. :* :** :*:.  *  ::* :*:  :