HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0612COG0284KOG1377arCOG00081Orotidine-5'-phosphate decarboxylaseorotidine-5'-monophosphate (Ura3)

HOG Organism Gene ID Name Annotation
cHOG0612 nrc1 VNG1673 pyrF orotidine-5'-monophosphate (Ura3)
cHOG0612 hmu HMUK1801 Hmuk_1801 orotidine 5'-phosphate decarboxylase( EC:4.1.1.23 )
cHOG0612 hma RRNAC1515 pyrF orotidine 5'-phosphate decarboxylase
cHOG0612 hwa HQ3219A pyrF orotidine-5'-phosphate decarboxylase
cHOG0612 hla HLAC1586 Hlac_1586 orotidine 5'-phosphate decarboxylase
cHOG0612 hbo HBOR10060 Hbor_10060 orotidine 5'-phosphate decarboxylase, subfamily 2( EC:4.1.1.23 )
cHOG0612 hut HUTA0923 Huta_0923 orotidine 5'-phosphate decarboxylase
cHOG0612 hvo HVO_2577 HVO_2577 pyrF orotidine 5'-phosphate decarboxylase
cHOG0612 nph NP1734A pyrF orotidine-5'-phosphate decarboxylase
cHOG0612 hhi 2085 pyrF orotidine 5'-phosphate decarboxylase
MUSCLE (3.6) multiple sequence alignment


1673|gene|nrc1      -------MSFVEELGARIEAADSVVSVGLDPDMERLPEDVQDAELPRWAFNRRIIDATHE
1734|gene|nph       -------MSFFETLADRIDDRDSVVSVGLDPDPDRLPEFL-DADLPRWAFNRRVIDATHE
3219|gene|hwa       MNSTDTNRPFFDRVATRISRINSVISVGLDSDPNRIPAHLQTADLPRWAFNRRIIDATHE
923|gene|hut        -------MTFFERLAGRIDAVDSVVSVGLDPDPDRLPDHLADRELPRWAFNRRIIDATHE
11515|gene|hma      -------MHFFDRLADRIATADSVVSVGLDPDPARLPDSVLDADLPRWQFNRRIIDATHE
2085|gene|hhi       -------MHFFDRLADRIATADSVVSVGLDPDPDRLPDSVLDADLPRWQFNRRIIDATHE
1586|gene|hla       -------MSFFETLADRIEATDSVVSVGLDPDPNRLPEFLANADLPRWAFNRRIIDATHE
10060|gene|hbo      -----MAQAFFERLADRIQQTDSVVSVGLDSDLSRIPDHLHEKDLPRWAFNRRIIDATHE
                             *.: :. **   :**:*****.*  *:*  :   :**** ****:******

1673|gene|nrc1      HAAVFKPNAAFYEDSDGWRALRETVAYAHGKGVPVLLDAKRADIGNTARQYAEILAH---
1734|gene|nph       HAACYKPNAAFYEDSDGWRALEETIAYAHGKGVPVLLDAKRGDIGNTARQYATLLDDD-G
3219|gene|hwa       HTVCYKPNTAFYEDPSGWRALRETIAYAHGKDVPVLLDAKRADIGNTTRQYAELLNK---
923|gene|hut        HAAAYKPNAAFYEDPDGWRALAETIAYAHGKDVPVLLDAKRGDIGNTARQYAEVLDGD-G
11515|gene|hma      HAACYKPNAAFYEDPDGWRALEETIAYAHGKNVPVLLDAKRGDIGNTARQYAQILDEDEG
2085|gene|hhi       HAACYKPNAAFYEDPDGWRALEETIAYAHGKDVPVLLDAKRGDIGNTARQYARILDDEEG
1586|gene|hla       HAACYKPNAAFYEDADGWRALEETIAYAHGKDVPVLLDAKRADIGNTTRQYAAALDR---
10060|gene|hbo      HAACYKPNAAFYEDADGWRALRETIAYAHGKDVPVLLDAKRADIGNTTRQYAKLLDE---
                    *:. :***:*****..***** **:******.*********.*****:****  *     

1673|gene|nrc1      --VDAITVNPYLGEDALQPFLTQDEAGVFVLCRTSNEGGMDFQHLELAAYDRRLYEHVAE
1734|gene|nph       LGADAITANPYMGRDTLEPYLSRADKGVFILCRTSNSGGADFQNLTVGN-DKRLYEYVAQ
3219|gene|hwa       --ADAITVNPYMGRDSLQPFLDRENKGVFILCRTSNPGGADLQDLELVT-GETVYERIAA
923|gene|hut        LDADAITVNPYMGRDSLEPFLAREETGVFVLCRTSNPGGADLQGLELQD-GEALYERVAA
11515|gene|hma      PAADAITVNPFLGRDSLEPFLQRADRGVFVLGRTSNPGGEDLQDLELAS-GEKLYERVVH
2085|gene|hhi       PAADAITVNPFLGRDSLEPFLQRADKGVFVLGRTSNPGGEDLQDLELAS-GEKLYERVVH
1586|gene|hla       --ADAITVNPYLGRDSLQPFLDREEKGVFVLCRTSNPGGSDLQDLELAS-GEPLYERVAA
10060|gene|hbo      --VDAITVNPYMGRDSLQPFLDRGDKGVFILCRTSNPGGEDLQDLELDS-GERVYERVAA
                      .****.**::* *:*:*:* . : ***:* **** ** *:* * :   .  :** :. 

1673|gene|nrc1      RAAEWNAQYGDVGLVVGATAPDELQAIRERVPELPFLVPGVGAQGGDAEAAVEYGLND--
1734|gene|nph       RCQEWNEH-ENVGLVVGATAPEELESVRDLV-DLPFLVPGVGAQGGDAAAAVDHGLAD--
3219|gene|hwa       LAEGWNTH-GNVGLVVGATAPEELESLREYVPDLPFLVPGIGAQDGDPEAAVTYGLVD--
923|gene|hut        LADLWNRN-DNVGLVVGATAPEELESLREQVPDLPFLVPGVGAQGGDAEAAVEHGLADVP
11515|gene|hma      LADLWNGN-GNVGLVVGATNPDELEEIRELVPDIPFLVPGVGAQGGDAEAAVEHGLAD--
2085|gene|hhi       LADLWNGN-GNVGLVVGATNPDELEEIRELVPDIPFLVPGVGAQGGDAEAAVEHGLAD--
1586|gene|hla       LADVWNGN-DNVGLVVGATAPEELAEVREIVPEIPFLVPGVGAQGGDAEAAVEHGLADRP
10060|gene|hbo      LADLWNRN-DNVGLVVGATAPDELESIREQVPDLPFLVPGIGAQGGDAEAAVEFGLAD--
                     .  ** :  :******** *:**  :*: * ::******:***.**. *** .** *  

1673|gene|nrc1      ---DGVGLVNSTRGVIFAGE--------HGSAWAAAAGDAARTLRERLNRHR---
1734|gene|nph       ----GVGLVNSSRGIIFAGE-----GAADEDEYFRAVGAAAKRLKQRLNKHR---
3219|gene|hwa       ----DVGLINSSRGIIFAGD-------DNGEQFADTAGVAAKRLKQQLNQFRDTA
923|gene|hut        GVDPQVGLVNSSRGIIFAGEEAGGPGDADPDAYYRAAGESAKRLKRRLNRHRDG-
11515|gene|hma      ----GVGLVNSSRGIIFAGEDAATRRDDSGDAFFKAAGQSAKQLKQRLNQFR---
2085|gene|hhi       ----GVGLVNSSRGIIFAGEDADTRRDDSGDAFFKAAGQSAKQLKQRLNQFR---
1586|gene|hla       DAAVDVGLVNSSRGIIFAGEESS--RPDDEATYFGAAGDAAKRLKKRLNQYR---
10060|gene|hbo      ----GVGLVNSSRGIIFAGE-------DNGEEFARGAGDAARRLKKRLNQYRDSQ
                         ***:**:**:****:            :   .* :*. *. .**..*