HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0611COG0218KOG2486arCOG00355Predicted GTPaseprobable GTP-binding protein

HOG Organism Gene ID Name Annotation
cHOG0611 nrc1 VNG2587 engB probable GTP-binding protein
cHOG0611 hmu HMUK0625 Hmuk_0625 GTP-binding protein HSR1-related
cHOG0611 hma RRNAC2378 engB GTP-binding protein
cHOG0611 hwa HQ3150A engB GTP-binding protein
cHOG0611 hla HLAC1378 Hlac_1378 small GTP-binding protein
cHOG0611 hbo HBOR05280 Hbor_05280 small GTP-binding protein domain
cHOG0611 hut HUTA1102 Huta_1102 small GTP-binding protein
cHOG0611 hvo HVO_1931 HVO_1931 GTP-binding protein
cHOG0611 nph NP0576A engB GTP-binding protein
cHOG0611 hhi 2816 engB small GTP-binding protein HSR1-like protein
MUSCLE (3.6) multiple sequence alignment


2587|chp|nrc1       MFKDRPDRSDEVVLVGRSNVGKSTLMRAVTGH-QVPTGQKPGVTRQPNHFDWASEDFMLT
576|gene|nph        MFETRPNRADEIVLVGRSNVGKSTLMREITGHDSFATGGSPGVTTKPNHYDWAGDDFVIT
1102|gene|hut       MFETRPDRSAEVVLAGRSNVGKSTLMRELTGH-TFDTGQRPGVTQEPNHYDWTSEDFVLT
12378|gene|hma      MFESRPDRDAEVVLIGRSNVGKSTLMREITGH-TFDTGQRPGVTRSPNHFDWASADFVIS
2816|gene|hhi       MFESRPDRDAEVVLVGRSNVGKSTLMREITGH-TFDTGQRPGVTRSPNHFDWASADFVIS
3150|gene|hwa       MSETRPDCD-EVVLLGRSNVGKSTLMRELTGHTGFTTGRKPGVTRSPNHYDWASESFMFT
1378|gene|hla       MFEDRPDRDAEVVLVGRSNVGKSTLMRELTGH-DFSTGGKPGVTRQPNHFDWASESFMFT
5280|gene|hbo       MFEDRPNCQ-EVVLVGRSNVGKSTLMRELTGHSKFTTGKKPGVTRQPNHFDWSGEKFMFT
                    * : **:   *:** ************ :***  . **  **** .***:**:. .*:::

2587|chp|nrc1       DLPGFGYMQGVEDGHEEAIKTEVVRYVESHADNIMVGVLVLDGKAAVDIIDRHSGGDEIP
576|gene|nph        DLPGFGFMSGVPEDVRESIKRDVVQYIEAHADNILAGILVVDGKAVVDIIDRHSGPDEIP
1102|gene|hut       DLPGFGYMKGVPDEVREQIKTDVVRYIEANADSILVGVLVVDGKSVIDIIDRHSGPDEIP
12378|gene|hma      DLPGFGFMKGVPEDVREEIKTDVVQYVERNAEHILVGILVVDGKSVIDIIDRHSGPDEIP
2816|gene|hhi       DLPGFGYMKGVPEDVREEIKTDVVQYVERNAEHILVGILVVDGKSVIDIIDRHSGPDEIP
3150|gene|hwa       DLPGFGFMSGVESSQREQIKTDIVRYIESNAESILAAVLVVDGKSAVEIIDRHSGPDEIP
1378|gene|hla       DLPGFGFMSGVEEEHREAIKTNIVRYLEENADSILAGVVVMDGKAAVDIIDRHAERGNIP
5280|gene|hbo       DLPGFGFMSGVEEHRREEIKTDIVRYLESNADDILAGVLVVDGKSVVDIIDRHSGPDEIP
                    ******:*.** .   * ** ::*.*:* :*: *:..::*:***:.::*****:  .:**

2587|chp|nrc1       HVVELYYLLEELGVQPVVAVNKMDKVDDRDERLNDIADRLGLYPPWEQWQDVIAPITAKK
576|gene|nph        HDVEMFGFLQELGIPTVVAVNKMDKVDDRDERLDELAERLGLYPPWQQFDEMLAPISAKR
1102|gene|hut       HDVELFHFLRDVGIPPVVAVNKMDKVDDRDERLNELCDRLGLHPPWKQWQGTIAPITAKR
12378|gene|hma      HDVEMFHFLREVGVEPVVAVNKMDKVDDKDARLNELCDRLGLHPPWQQWQETIAPISAKH
2816|gene|hhi       HDVEMFHFLREVGVEPVVAVNKMDKVDDKDDRLNELCDRLGLHPPWQQWQETIAPISAKR
3150|gene|hwa       HDIELFSFLWELDLPTVVAVNKIDKVENKDNQLDDLCDRLGLYPPWQQWQDTIAPISAKR
1378|gene|hla       HDVEMFGFLEDVGVEPIVAVNKTDKIDDLDERLDEICDRLGLYPPWQQWSDQIAPICAKR
5280|gene|hbo       HDVEMFHFLRELGVPVVVAVNKMDKVDDKDERLDELCDRLGLMPPWKQWSDVIAPICAKR
                    * :*:: :* ::.:  :***** **::: * .*:::.:**** ***:*:.  :*** **.

2587|chp|nrc1       DRIAALEDAVNSHFDAAKRDDLKQFFS
576|gene|nph        GSIEPLNQAVRHHLHEQKRDDLFKFF-
1102|gene|hut       GSIDPLTEAVRDHLHEAERDDLFQFF-
12378|gene|hma      GSTEPLNEAVRHHLHEVQRDDLFQFF-
2816|gene|hhi       GSVEPLNEAVRHHLHEAQRDDLFQFF-
3150|gene|hwa       GSIEPLEEALQAIFSDQRRDDLLKFVT
1378|gene|hla       GDIEALEECLRTRFHEHNRDDLLKFVS
5280|gene|hbo       GSIDPLYESLQTYFHEQKRDDLLKFVS
                    .   .* :.:.  :    **** :*.