HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0610COG2262arCOG00353GTPasesGTP-binding protein

HOG Organism Gene ID Name Annotation
cHOG0610 nrc1 VNG1275 hflX2 GTP-binding protein
cHOG0610 hmu HMUK2404 Hmuk_2404 GTP-binding proten HflX
cHOG0610 hma RRNAC1169 hflX GTP-binding protein HflX
cHOG0610 hwa HQ2339A hflX GTP-binding protein
cHOG0610 hla HLAC1303 Hlac_1303 GTP-binding proten HflX
cHOG0610 hbo HBOR18880 Hbor_18880 GTP-binding protein HflX
cHOG0610 hut HUTA0828 Huta_0828 GTP-binding proten HflX
cHOG0610 hvo HVO_1346 HVO_1346 hflX GTP-binding protein HflX
cHOG0610 nph NP3742A hflX GTP-binding protein
cHOG0610 hhi 1772 hflX GTP-binding protein HflX
MUSCLE (3.6) multiple sequence alignment


1275|gene|nrc1      -VTGD------------TTATAVVAKRVDDG-TPETAEIRDLVQAAGYELVGEVTQSRTA
3742|gene|nph       -MTGT-------------NGTAVVAKRVDDG-HPDTAEIRDLAAAAGYTVAGEVTQTRTE
828|gene|hut        -MTGT----------DRPTDGAIVVKRVDEG-SADTTEIKRLADAAGYDVLATLTQTRTE
11169|gene|hma      ------------------------------------------------------------
1772|gene|hhi       -MTAT-----------HTTKRAVIAKRVDSG-TADTTEIRDLARAAGYEVVDEITQTRTE
1303|gene|hla       -MTGSVEGRDTDTEPTAAERRAVVAKRVESG-SADLTEITQLAAAAGYDVVGELTQTRTE
2339|gene|hwa       -MTIS---------------PVIVAQRVDPNAVADLSEIADLARAAGYDVSNTLTQSREE
18880|gene|hbo      MSDGT---------------NAIVAKRVNSGESADLSEITDLARAAGYEVVGTLSQSRKE
                                                                                

1275|gene|nrc1      DPALQLGAGKVTELAERVARTDADRVVFDNRLGPYQTFNLGQELPDGTEVVDRFRLILDI
3742|gene|nph       DPALCLGEGKVAELADLVADTGATTVVFDNRLGPYQTYNLGNNLPKGTEVVDRFKLILDI
828|gene|hut        DPAYHVGEGKAAEIAEELRARDATVVIFDNQLGPYQTYNLGTEFPEGVQLLDRFRLILEI
11169|gene|hma      ------------------------------------------------------------
1772|gene|hhi       DPAYHLGEGKVTRLSNAVAREGAAVVIFDNQLGPYQTYNIGNELPERVRVIDRFRLILEI
1303|gene|hla       DAAFMFGEGKVAELRDLVRRTDANAVIIDNDVGPYQTFNIGGELPEGVEVIDRFALILEI
2339|gene|hwa       DAAYHFGEGKIEALARLVKQTDAEAVIVDNRLGPYQTYNIGGKLPTGVEVIDRFTLILEI
18880|gene|hbo      DAAFHFGEGKVDELTALVAETDAAAVIVDNRLGPYQTYNIGGKLPEGVEVIDRFTLILEI
                                                                                

1275|gene|nrc1      FGQRANTRKAQLQVELAELRYELPRAEAKTSLAKRNERPGFMGLGEYDESREQDIKARIS
3742|gene|nph       FGQRAQTKKAQLQVELAELRYELPRAEAKASLAKRDERPGFMGLGEYDESREQDIKAQIS
828|gene|hut        FGQRAQTRKAQLQVELAELRYELPRAEAKASLARREEHPGFMGLGEYDESREQDIKNRIS
11169|gene|hma      -----------------------------------------MGLGEYDESREEDIKKQIS
1772|gene|hhi       FGQRAQTRKAQLQVELAELRYELPRAEAKASLAKRDERPGFMGLGEYDESREEDIKKQIA
1303|gene|hla       FGQRANTRKAQLQVELAELRYELPRAEAKASLAKRDERPGFMGLGEYDESVERDIKRQIS
2339|gene|hwa       FGQRANTRKAQLQVELAELRYELPRVEAKSSLAKRDERPGFMGLGEYDESRERDIKSQIS
18880|gene|hbo      FGQRANTRKAQLQVELAELRYELPRAEAKASLAKRDERPGFMGLGEYDESREQDIKNQIS
                                                             ********* * *** .*:

1275|gene|nrc1      RIRDELSNIEKTEQQRRETRRESGFDLVALAGYTNAGKSTLLRRLAADVAVDENDDRHPD
3742|gene|nph       RIRDELERIEQTEEHRREQRRESGFDLVALAGYTNAGKSTLLRRLAADVDIDENEGLHPD
828|gene|hut        RIRDELEKIERTDEHRREQRRESGFDLVALAGYTNAGKSTLLRRLAEDLDVDENEDVHPD
11169|gene|hma      NIRDELESIEETERHRREQRRESGFDLVALAGYTNAGKSTLLRRLADDLDVDENDDLHPD
1772|gene|hhi       NIRDELESIEETERHRREQRRESGFDLVALAGYTNAGKSTLLRRLADDLDVDENDDLHPD
1303|gene|hla       EIRDELASIAEKEEARREQRRDSGFDLVALAGYTNAGKSTLMRRLAAEIDVDENAERHPD
2339|gene|hwa       RISQELDAIAEKEQTRREQRRESGFDLVALAGYTNAGKSTLLRRLADDLDITENKNRHPD
18880|gene|hbo      RIKNELDSIAEKEETRREQRRESGFDLVALAGYTNAGKSTLMRRLAEDLEVGENEDLHPD
                     * :**  *  .:  *** **:*******************:**** :: : **   ***

1275|gene|nrc1      LDTTAESQDDLFTTLGTTTRRMELARRDVLLTDTVGFISDLPHWLVESFKSTLESVYQAD
3742|gene|nph       LDATAESEDRLFTTLGTTTRRADFDRRDVLVTDTVGFISDLPHWLVESFKSTLSEVYRAD
828|gene|hut        LDETAESEDRLFTTLGTTTRRADFDRRDVLVTDTVGFISDLPHWLVESFKSTLGSVYQAD
11169|gene|hma      LDTTAESEDRLFTTLGTTTRRAEVGKREVLVTDTVGFIQDLPHWLVESFKSTLGSVYHAD
1772|gene|hhi       LDTTAESEDRLFTTLGTTTRRAAVGKREVLVTDTVGFIQDLPHWLVESFKSTLGSVYHAD
1303|gene|hla       LDTTAESQDMLFTTLGTTTRRAEMEKRDVLLTDTVGFIADLPHWLVESFESTLDSVYRAD
2339|gene|hwa       LEQTAESEDRLFTTLGTTTRRADTGRRDVLLTDTVGFVSDLPHWLVESFESTLDSVYRAD
18880|gene|hbo      LDPTAESEDRLFTTLGTTTRRADTGTRDVLLTDTVGFVSDLPHWLVESFKSTLDSVYRAD
                    *: ****:* ***********     *:**:******: **********:*** .**.**

1275|gene|nrc1      LVLLVVDASEPLADIQEKLATSHDTLYERNEAPIVTVFNKTDRVEDAALAEKMEALAALA
3742|gene|nph       LVLLVVDVSDPVEEIREKLVTCHDTLYERNEAPIVTVLNKIDRVDDEELERKREALSALA
828|gene|hut        LVLLVVDVGESVESIREKLVTAHDTLYERNEAPILTVLNKIDTVEAAELDRKREALSALA
11169|gene|hma      LVLLVVDVSESVEEIREKLVTSHDTLYERNEAPIVTVLNKTDMVDDEEVRRKRDALSSLA
1772|gene|hhi       LVLLVVDVSESVEEIREKLVTSHDTLYERNEAPIVTVLNKTDMVDDEEVRRKKDALSSLA
1303|gene|hla       LVLLVVDASEPVETMREKLVTSHDTLYERNEAPVVTVFNKVDRLAPGELADKRAALSGVA
2339|gene|hwa       LVLLVVDASESIDAMREKLITSHDTLYERNEAPIVTVLNKTDCVEEGELDRKMQSLDALA
18880|gene|hbo      LVLLVVDASEPVEEMRDKLVTCHDTLYERNEAPIVTVLNKIDKVDADELGRKMDALQALA
                    *******..:.:  :.:** *.***********::**:** * :    :  *  :* .:*

1275|gene|nrc1      PAPVAVSARDASNLEELRERIDAALPARERERLVLPMTEDTMSVVSWVHDHAHVRTVDY-
3742|gene|nph       PEPIVVSAKTGENVDSLRERIDEELPDWRRERLVVPMTDDTMSFVSWVHDHGHVDSVDY-
828|gene|hut        PNPVAVSARTGENVDALRERIDESLPELEHERLVLPMTDDAMSVVSWIHDHAHVEDVDY-
11169|gene|hma      PNPVAVSAEQGLNIDDLAERIDHELPDYERERLVLPMTDDTMSLVSWIHDHASVETVDY-
1772|gene|hhi       PNPVAVSAKQGLNIDDLADRIDHELPDYERERLVLPMTDDTMSLVSWIHDHASVETVDY-
1303|gene|hla       PDPVAVSAKTSAGVAELRDRVEAELPDWERERLVLPLSDDAMSLVSWIHDHGHVEAETY-
2339|gene|hwa       PNPVAVSGLTGENIEQLTNRIENELPSWHDERLLLPLSDDAMSLVSWLYNHGHVENEEYT
18880|gene|hbo      PNPVSVSGLTGENVGALADRIERELPDWREERLLLPMSDDTMSLVSWLYDHGNVKNEAY-
                    * *: **.  . .:  * :*::  **    ***::*:::*:**.***:::*. *    * 

1275|gene|nrc1      --GDQEVVIDFEARPTIVERSHAKASDLV------AEA----------------------
3742|gene|nph       --GD-EVIIDFEARPAIIEQARARASELP-----AAAAE---------------------
828|gene|hut        --GE-EVVVEFEGRPAVVEQSRAKASDLV-----PAESAS--------------------
11169|gene|hma      --GD-QVVIEFEARPAIIEQSRAKAGDLV-----GASA----------------------
1772|gene|hhi       --GD-QVVIEFEARPAIIEQSRAKAGELV-----GASA----------------------
1303|gene|hla       --ADDQVTLDFEAKPSIVARARSKAAGLA-----PAGST---------------------
2339|gene|hwa       DTGD-AVLIEFSARSTIVKRARAKAAELEESSSKGASDESANTHDSNGVNTKTQAQLSER
18880|gene|hbo      -EGE-NVLVEFEARPAIVEKARAKAAEVQAGTDGEAEAEAEPDGGYQT------------
                      .:  * ::*....::: .:.:.*. :       *                        

1275|gene|nrc1      ------------------------------------------------------------
3742|gene|nph       ------------------------------------------------------------
828|gene|hut        ------------------------------------------------------------
11169|gene|hma      ------------------------------------------------------------
1772|gene|hhi       ------------------------------------------------------------
1303|gene|hla       ------------------------------------------------------------
2339|gene|hwa       RHDNEIMESESNPERMDTASDRESTSYEESDTTHQVASDSPPDRMSDSTREIHRNNPSQV
18880|gene|hbo      ------------------------------------------------------------
                                                                                

1275|gene|nrc1      --------------------------------------
3742|gene|nph       --------------------------------------
828|gene|hut        --------------------------------------
11169|gene|hma      --------------------------------------
1772|gene|hhi       --------------------------------------
1303|gene|hla       --------------------------------------
2339|gene|hwa       TEDDVTQEDHIDAVDIDVNYPLMNEKNSSDTDTNSKAE
18880|gene|hbo      --------------------------------------