HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0061COG1782arCOG00543Predicted metal-dependent RNase consists of a metallo-beta-lactamase domain and an RNA-binding KH domainmRNA 3'-end processing factor homolog

HOG Organism Gene ID Name Annotation
cHOG0061 nrc1 VNG0401 epf2 mRNA 3'-end processing factor homolog
cHOG0061 hmu HMUK3129 Hmuk_3129 beta-lactamase domain protein
cHOG0061 hmu HMUK2052 Hmuk_2052 beta-lactamase domain protein
cHOG0061 hma RRNAC0155 epf2b mRNA 3'-end processing factor-like
cHOG0061 hma RRNAC1310 epf2a mRNA 3'-end processing factor-like
cHOG0061 hwa HQ1716A epf2 mRNA 3'-end processing factor-like protein
cHOG0061 hla HLAC0966 Hlac_966 beta-lactamase domain protein
cHOG0061 hbo HBOR23470 Hbor_23470 predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain
cHOG0061 hut HUTA2698 Huta_2698 beta-lactamase domain protein
cHOG0061 hvo HVO_0874 HVO_0874 epf mRNA 3''-end processing factor homolog
cHOG0061 nph NP0210A mRNA 3'-end processing factor
cHOG0061 hhi 1901 epf2 mRNA 3'-end processing factor-like protein
cHOG0061 hhi 906 epf1 mRNA 3'-end processing factor-like protein
MUSCLE (3.6) multiple sequence alignment


11310|gene|hma      MSSADETLDRIKAQVEEETPDDIEIESVAFEGPELVIYTPDAQTVANRDGIVRNLAQTLR
1901|gene|hhi       MSSADETLDRIKAQVEEETPDDIEIDSVAFEGPELVIYTPDAQTVANRDGIVRNLAQTLR
10155|gene|hma      MSTVDKQLEDVKATIDEEVPRRISVSDVTYEGPELVIYTRDPKEFAANSDLVRRLASKLR
906|gene|hhi        MSTVDKQLEDVKATIDEEVPRRISVSDVTYEGPELVIYTRDPKEFAANSDLVRRLASKLR
401|gene|nrc1       MSTVDRQLEELQDEIVSEIPADISVTDVKYEGPELVVYTRDPKQFAQDGDLVRRLASKLR
1716|gene|hwa       MSSVDTQLEELKSEIMAELPSDISVSDVTYEGPELVVYTRDPKRFAKNGDLVRDLAGKLR
23470|hp|hbo        MSSVDKQLEELKAEITNELPSDISVSDVKYEGPELVVYTRDPKKFAQNGDLIRKLASKLR
966|gene|hla        MSQVDKQLDTLKSEIEQEIPNDITVTDVKYEGPELVVYTRDPKEFAGDGDLIRRLASKLR
210|gene|nph        MSAVERKLDDIKSTIVSEVPNDISVSDVKYEGPELVVYTKDPKRFASDGDLVRQLASKLR
2698|gene|hut       MSNVDQQLADTKETIVSEVPNDISITDVTYEGPELVIYTRDPKSFAENGDLVRRLASKLR
                    ** .:  *   :  :  * *  * : .* :******:** *.: .*  ..::* ** .**

11310|gene|hma      KRINVRPTQEALVPPNEARAQITQTIPEDAGVQNLDFDRQTGEVFIEAEKPGRVIGRHGA
1901|gene|hhi       KRINVRPTQEALVPPNEARARITQTIPEDAGVQNLDFDRQTGEVFIEAEKPGRVIGRHGA
10155|gene|hma      KRITVRPDPDVLAPPAEAEEAIRELIPEEAGVMDLNFHADTGEVVVQAQKPGVVIGRRGS
906|gene|hhi        KRITVRPDPDVLAPPAEAEEAIRELIPEEAGVMDLNFHTDTGEVVVQAQKPGVVIGRRGS
401|gene|nrc1       KRITVRPDPAVLSSPKRARDRVLDVIPEEAGVTNLDFHEDTGEVVIEAEKPGMVIGRHGS
1716|gene|hwa       KRITIRPDPEELASPARAQDQIHDVIPDEAGVTDLDFHHDTGEVVIEAEKPGIVIGRGGE
23470|hp|hbo        KRITVRPDPDVLSPPREAEERVLSVIPEEAGVTDLDFHEDTGEVVIEASKPGMVIGRHGS
966|gene|hla        KRITIRPDPSALAPPARAEEEVRSVIPEEAGVTDLDFHEDTGEVVIEAEKPGMVIGRRGS
210|gene|nph        KRITVRPDPEVLSRPSDAREQIMSVIPEEAGVTDLDFHPDTGEVVIEAEKPGMVIGRHGS
2698|gene|hut       KRITVRPDTDVLSPPREARDEVHSVIPEEASVTDLDFHEDTGEVVIEAEKPGMVIGRHGS
                    ***.:**    *  *  *   : . **::*.* :*:*  :****.::*.*** **** * 

11310|gene|hma      TLDEISASVGWTPEVVRTPPMESSTVSNVRNYLKQEREERRDILQRVGRQINRPTTSDED
1901|gene|hhi       TLDEISASVGWTPEVVRTPPMESSTVSNVRNYLKQEREERRDILQRVGRQINRPTTSDED
10155|gene|hma      TLREITQEVGWTPEVVRTPPIESSTVENVRNFLKQEREDRRDILERVGRQIHREPMSDDE
906|gene|hhi        TLRDITQEVGWTPEVVRTPPIESSTVENVRNFLKQEREDRRDILERVGRQIHREPMSDDE
401|gene|nrc1       TLREITQEAGWTPEVVRTPPIESSTVSNVRNFLKQERDERRDILETVGRQIHREEMQDDE
1716|gene|hwa       TLREITQQVGWTPEVVRTPPIESSTVSNVRNFLKQERDERRDILERVGRQIHREELSDDE
23470|hp|hbo        TLREITKEVGWTPEVVRTPPIESSTVSNVRNFLKQERDERRQILERVGRQIHREQLSDDE
966|gene|hla        TLREITQKVGWTPEVVRTPPIESSTVSNVRGFLKNEREERRDILERVGRQIHREEMSDDE
210|gene|nph        TLREITQEVGWTPEVVRTPPIESSTVSNVRNFLKQEREERRDILERIGRQIHREEMSDDE
2698|gene|hut       TLREITQKVGWTPEVVRTPPIESSTVSNVRNFLKQERDDRRDILERVGRQIHREEMSDDE
                    ** :*: ..***********:*****.***.:**:**::**:**: :****:*   .*::

11310|gene|hma      WVRLTTLGCCREVGRAAFILSTPESRILIDCGDKPGAEGEVPYLQAPEALAAGPNSLDAV
1901|gene|hhi       WVRLTTLGCCREVGRAAFILSTPESRILIDCGDKPGAEGEVPYLQAPEALAAGPNSLDAV
10155|gene|hma      YVRITTLGCCREVGRAAFILSTPDTRILIDCGNKPGANGEQPYLDIPEAFGAGTNGIDAV
906|gene|hhi        YVRITTLGCCREVGRAAFILSTPDTRILIDCGNKPGSNGEQPYLDIPEAFGAGTNGIDAV
401|gene|nrc1       YVRVTTLGCCREVGRASFVLSTPETRILVDCGDKPGSEDEVPYLQVQEALAGGANTIDAV
1716|gene|hwa       WVRISTLGCCREVGRASFVLSTPETRILIDCGDKPGSD-DVPYLQAPEALGSGASSVDAV
23470|hp|hbo        WVRISTLGCCREVGRASFILSTPETRILIDCGDKPGSD-DVPYLQVPEALGSGANSLDAV
966|gene|hla        WVRITTLGCCREVGRAAFILSTPETRVLIDCGDKPGAEGEVPYLQVPEALGAGAATLDAV
210|gene|nph        WVRITTLGCCREVGRAAFILNTPETRVLIDCGDKPGAEGEVPYLQVPEALGAGASNLDAV
2698|gene|hut       WVRITTLGCCREVGRASFILSTPETRVLIDAGDKPGAEDEYPYLQVPEALGVGASSIDAV
                    :**::***********:*:*.**::*:*:*.*:***:: : ***:  **:. *.  :***

11310|gene|hma      VLTHAHLDHSALIPILFKYGYDGPIYTTAPTRDLMGLLQLDYLDVASKEGRTPPYESQQV
1901|gene|hhi       VLTHAHLDHSALIPILFKYGYDGPIYTTAPTRDLMGLLQLDYLDVASKEGRTPPYESQQV
10155|gene|hma      VLTHAHLDHSALVPLLFEYGYDGPIYCTEPTRDLMGLLTLDHLDTAADDGRTPPYDSEMV
906|gene|hhi        VLTHAHLDHSALVPLLFEYGYDGPIYCTEPTRDLMGLLTLDYLDTAADDGRTPPYDSEMV
401|gene|nrc1       ILTHAHLDHSAFIPLLFKYGYDGPIYCTEPTRDLMGLLTLDYLDVAAKEGRAPPYDSEMV
1716|gene|hwa       VLTHAHLDHSALLPLLFKYGYDGPIYTTEPTRDLMGLLQLDYLDVAAKEGRTPPYDSSMV
23470|hp|hbo        ILTHAHLDHSALIPLLFKYGYDGPIYTTEPTRDLMGLLTLDYLDVAAKEGRTPPYESEMV
966|gene|hla        VLTHAHLDHSAFVPLLFKYGYDGPIYTTEPTRDLMGLLTLDYLDVAAKEGRTPPYESSQV
210|gene|nph        VLTHAHLDHSALIPLLFKYGYDGPIYCTEPTRDLMGLLTLDYLDVASKEGRTPPYDSSQV
2698|gene|hut       VLTHAHLDHSALIPLLFKYGYDGPIYTTEPTRDLMGLLTLDYLDVAAKEGRAPPYDSEMV
                    :**********::*:**:******** * ********* **:**.*:.:**:***:*. *

11310|gene|hma      RDALKHTIPLEFGNVTDIAPDIKLTMHNAGHILGSAVCHFHIGEGRYNVAFSGDIHYKDT
1901|gene|hhi       RDALKHTIPLEFGNVTDIAPDIKLTMHNAGHILGSAVCHFHIGEGRYNVAFSGDIHYKDT
10155|gene|hma      REAIKHTIPLEYGDVTDIAPDIKLTLHNAGHILGSSVCHFHVGDGLYNVAFSGDIHYDDT
906|gene|hhi        REAIKHTIPLEYGDVTDIAPDIKLTLHNAGHVLGSSVCHFHVGDGLYNVAFSGDIHYDDT
401|gene|nrc1       REAIKHCIPLEYGDVTDIAPDVKLTFHNAGHILGSAVSHFHIGDGLYNVAFSGDIHYDDT
1716|gene|hwa       RETIKHTIPLEYGDVTDIAPDVKLTFHNAGHILGSAVTHFHIGDGLYNVAFSGDIHYEDT
23470|hp|hbo        REAIKHCIPLEYGDVTDIAPDVKLTFHNAGHILGSAVSHFHIGDGLYNVAFSGDIHYEDT
966|gene|hla        REAIKHTIPLEYGDVTDIAPDVKLTFHNAGHILGSSVTHFHIGDGLYNVAFSGDIHYEDT
210|gene|nph        REAIKHCIPLEYGDVTDIAPDLKLTFHNAGHILGSAVTHFHVGDGLYNVAFSGDIHYDDT
2698|gene|hut       REAIKHTIPIEYGDVTDISPDIKLTMHNAGHILGSAISHFHIGDGLYNVAFSGDIHYDDT
                    *:::** **:*:*:****:**:***:*****:***:: ***:*:* ***********.**

11310|gene|hma      RLLDGAVNDFPRVETLVLESTYGGKNDYQTDQSDSERVLRDVINESYENDGKVLIPAFAV
1901|gene|hhi       RLLDGAVNDFPRVETLVLESTYGGKNDYQTDQSDSERVLRDVINEAYENDGKILIPAFAV
10155|gene|hma      RLFDGAVNDFPRVETLVLESTYGGRNDYQTDQEDSERKLKQIIQNAYDRNGKVLIPTFAV
906|gene|hhi        RLFDGAVNDFPRVETLVLESTYGGRNDYQTDQEDSERKLKQIIQNAYDRDGKVLIPTFAV
401|gene|nrc1       RLFNGAVNDFPRVETLVMESTYGGRNDYQTDQEDSERKLKRVINETYEDGGKVLIPAFAV
1716|gene|hwa       RLFNGAVNDFPRVETLVLESTYGGRDDYQTDQEDSERELIEVINETYDRDGKVVIPAFAV
23470|hp|hbo        RLFNGAVNDFPRVETLVLESTYGGRNDYQTDQADSEEKLIDVINETYDRGGKVLIPAFAV
966|gene|hla        RLFNGAVNDFPRVETLVLESTYGGRNDYQTDQADSEEALKEVINETYDQGGKVVIPAFAV
210|gene|nph        RLFNGAVNDFPRVETLVLESTYGGRNDYQTDQEDSEETLKEIIRETTTEGGKVLIPAFAV
2698|gene|hut       RLFNGAVNEFPRVETLVLESTYGGRNDYQTDQADSEQRLKEIIRETYERDGSVLIPAFAV
                    **::****:********:******.:****** ***  *  :*.::   .*.::**:***

11310|gene|hma      GRSQELMLVLEEAMRKGDIPTMPVYLDGMIREATAIHTAYPEYLRDDLRQRILYEDENPF
1901|gene|hhi       GRSQELMLVLEEAMRKGDIPTMPVYLDGMIREATAIHTAYPEYLRDDLRQRILYEDENPF
10155|gene|hma      GRSQELMLVLEEAMRNGDIPEMPVHLDGMIWEATAVHTTYPEYLRDGLQDRIFDEDKNPF
906|gene|hhi        GRSQELMLVLEEAMRNGDIPEMPVHLDGMIWEATAVHTTYPEYLRDGLQDRIFDEDQNPF
401|gene|nrc1       GRSQEMMLVLEEAMREGEIPEMPIHLDGMIWEATAIHTTYPEYLRDDLRDRIFHSDSNPF
1716|gene|hwa       GRSQEIMLVLEEAMRTGEIPQMPVHLDGMIWEATAIHTTYPEYLRDNLRDRIFHDDENPF
23470|hp|hbo        GRSQEIMLVLEEAMRSGKIPSMPVHLDGMIWEATAIHTTYPEYLRDDLRDRIFHEDENPF
966|gene|hla        GRSQEIMLVLEEAMRNGDIPEMPVHLDGMIWEATAIHTTYPEYLRDDLRDRIFHDDENPF
210|gene|nph        GRSQEIMLVLEEAMREGEIPTVPVHLDGMIWEATAIHTTYPEYLRDDLRDRIFHDDENPF
2698|gene|hut       GRSQELMLVLEEAMREGDIPEMPVHLDGMMWEATAIHTTYPEYLRDDLRDRIFHDDENPF
                    *****:********* *.** :*::****:.****:**:*******.*.:**: .*.***

11310|gene|hma      LAEQFEQVDGGDEMRQDIADDEPAIILTTSGMVTGGPVMSWLRLLGSDPDSTMAFVGYQA
1901|gene|hhi       LAEQFEQVDGGDEMRQDIADDEPAIILTTSGMVTGGPVMSWLRLLGSDPDSTMAFVGYQA
10155|gene|hma      LADRFNPIDGGDEEREEIADGDSCIILSTSGMLTGGPVMSWLDQLGPDPDSTLTFVDYQA
906|gene|hhi        LADQFNHIDGGDEERQEIADGDSAIILSTSGMLTGGPVMSWLEQLGPDPDSTLTFVDYQA
401|gene|nrc1       LAPQFNHIDGGEEERQAVADDDQCIILSTSGMVSGGPIMSWLEHIAPDPDSTLTFVGYQA
1716|gene|hwa       LAEEFNHIDAGEEERQAVSDGEPCIVLSTSGMITGGPIMSWLQHIGTDPDSRLVFVGYQA
23470|hp|hbo        LADEFNHIDGGEDERQDVADDGPAIILSTSGMVTGGPIMSWLRHVGPDPKSRLVFVGYQA
966|gene|hla        LADQFNHIDAGEDERQDVADGDECIIISTSGMIEGGPIMSWLRHIGPDPDSNLVFVGYQA
210|gene|nph        LADQFNHIDGGEEERQEVADGGPCIVLSTSGMVEGGPIMSWLNHIGSEEKSTMTFVGYQA
2698|gene|hut       LADQFNHIDGGEEERQEVTDGEPAIVLSTSGMVTGGPIMSWLEHFGSDPDSTLTFVGYQA
                    **  *: :*.*:: *: ::*.  .*:::****: ***:****  ...: .* :.**.***

11310|gene|hma      EGTLGRQIQRGQDEITLGDTSG-PRAERVSLRLNVETVDGFSGHADRQGLESFVETMHPR
1901|gene|hhi       EGTLGRQIQRGQDEITLGDTSG-PRAERVSLRLNVETVDGFSGHADRQGLESFVETMHPR
10155|gene|hma      EGTLGKRIQRGIDEVPVSGS---GRNEKVPLEMTVETVDGFSGHADRQGLENFVKTMNPR
906|gene|hhi        QGTLGNRIQRGVDEAPVGGN---GRSETVPLEMTVETVDGFSGHADRQGLENFVKTMNPR
401|gene|nrc1       QGTLGRRIQSGRDKIPMPDSRSGGRTEHLQLNMGVETVDGFSGHADRQGLEDFVRTMNPR
1716|gene|hwa       QGTLGRRIQDGWDEIPINGDQL-GRSETLTLEMDVTTVSGFSGHADRQGLENFVKTMNPR
23470|hp|hbo        QGTLGRRIQNGWDEIPVNDRDNVGRSNTLQLKMDVETVDGFSGHADRAGLENFVKTMNPR
966|gene|hla        QGTLGRRIQNGWDEIPVDGWGGGGRGDTLTLQMGTEVVDGFSGHADRQGLENFVKTMNPR
210|gene|nph        QGTLGSRIQSGWDEIPMNDRGN-GRG-TLKLNMNVETVDGFSGHADRQGLMNFVRTMNPR
2698|gene|hut       QGTLGRRIQNGWDEIPMNNGNGRGRGNTLSLEMNVETVDGFSGHADRQGLENFVKTMNPR
                    :**** .** * *: .: .     *   : * : . .*.******** ** .** **:**

11310|gene|hma      PEKILCVHGDASTTNQLSSALYQKFNMRTHNPKNLETFRLS
1901|gene|hhi       PEKILCVHGDASTTNQLSSALYQKFNMRTHNPKNLETFRLS
10155|gene|hma      PEKILCVHGDESATQDLSSSLYHDQNIRTFAPENLETFRFR
906|gene|hhi        PEKILCVHGDESATQDLSSSLYHDQNIRTFAPENLETFRFR
401|gene|nrc1       PEKVLCVHGDESSTQDLSSALYHEFNMRTFAPKNLETFRFV
1716|gene|hwa       PEKILCVHGDEQSVQDLSSGLYHDYNLRTFAPKNLETFRFL
23470|hp|hbo        PEKVLCVHGDERSVQDLSSALYHNYNMRTFAPKNLETFRFR
966|gene|hla        PEKVLCVHGDESSVQDLSSALYHDYNMRTFAPKNLETFRFK
210|gene|nph        PEKVLCVHGDESSVQDLSSALYHEFNMRTFAPKNLETFRFK
2698|gene|hut       PEKVLCVHGDESSVQDLSSALYHEYNMRTFAPKNLETFRFV
                    ***:******  :.::***.**:. *:**. *:******: