HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0609COG1402arCOG04536Uncharacterized protein putative amidaseputative amidase [General function prediction only]

HOG Organism Gene ID Name Annotation
cHOG0609 nrc1 VNG0124 amd putative amidase [General function prediction only]
cHOG0609 hmu HMUK0580 Hmuk_0580 Creatininase
cHOG0609 hma PNG7317b hypothetical protein
cHOG0609 hwa HQ1759A hypothetical protein
cHOG0609 hla HLAC0080 Hlac_80 Creatininase
cHOG0609 hbo HBOR27250 Hbor_27250 uncharacterized protein, putative amidase
cHOG0609 hut HUTA1831 Huta_1831 Creatininase
cHOG0609 hvo HVO_0507 HVO_0507 creatinine amidohydrolase
cHOG0609 nph NP0414A hypothetical protein
cHOG0609 hhi 5235 HAH_5235 creatininase
MUSCLE (3.6) multiple sequence alignment


1831|gene|hut      -------------MRLAESTWAQAEAI--ETDLAILPVGSTEQHGPHAPLGTDAIIAEAV
414|hp|nph         -------------MHLSEATWTDIRDA--TTDLAVLPVGSTEQHGPHAPLGVDWLTAEAI
124|chp|nrc1       MAAYKRRGRVPSRMRLADATWTDADGV--DTDLAVLPVGSTEQHGPHAPLGTDHITAHAV
80|gene|hla        -------------MRLADATWTDVRDA--DIDVAFVPVGSTEQHGPHAPLGTDTLNAVAV
27250|hp|hbo       -------------MRLSEATWTDVSDLAGETNLAFLPVGSTEQHGPHAPLGTDAFTAEAV
1759|hp|hwa        -------------MHIEDETWTDLETT--DTNLGLLPIGSTEQHGPHAPLGTDTFDAEVI
7317|hp|hma        -------------MELETEAWTDMTEV--ETDLALLPVGSTEQHGPHAPLGTDTLDAEVV
5235|gene|hhi      -------------MDLQTETWTDMAAV--ETSLALLPVGSTEQHGPHAPLGTDTLDAEAV
                                * :   :*::        .:..:*:*************.* : * .:

1831|gene|hut      ADAGVEAYP-------GDAVVAPPITVGVSEEHRAFPGSLWVSEDTFRATVRETVASLAH
414|hp|nph         AEAGVDRYA---DTHGEKPLVGPTIPVGVAEEHRDFDGTLWVSPDTFRSYVGETVASLAS
124|chp|nrc1       AAAGADAYS------DGEVIVAPPITVGVSAEHRQFTGTLWVAPDTFRATVRDVVGSLAS
80|gene|hla        AEAGAAAYEAVETESSADVVVTPPIPVGVAEEHRAFDGTMWISPDTFRAYVREAAESLPH
27250|hp|hbo       ADAGSEAYD-------GEVVVAPTLPIGVAAEHRQFPGTLWLSPDTFRDTVRETVASLAS
1759|hp|hwa        AQNAAEEYS-------DSVIVAPSVPVGIAEEHREFTGTLWTDEMTFRQYVRDIVRSLAS
7317|hp|hma        AEHGAERHD-------DPVVVAPAVPVGVAEEHRAFSGTLWTSESTFRSYVRDIVRSLAS
5235|gene|hhi      AERGAERYD-------DPVVVAPAVPVGVAEEHRAFTGTLWTSESTFRSYVRDIVRSLAS
                   *  .   :           :* *.:.:*:: *** * *::*    ***  * : . **. 

1831|gene|hut      HGWDRVVIVNGHGGNVNPLREVCARISRHD--DAYAVPFTWFEAVDPGDISMGHAGPMET
414|hp|nph         HGFERVVIVNGHGGNVDALNEVCARLTRDG--DAYAVQYTWFDAVD--FASLGHGGPAET
124|chp|nrc1       HGWDRVVVVNGHGGNTAALGEVCATITRQD--DAYAVPFTWFDAVGDHSSDMGHAGPLET
80|gene|hla        HGIDRVVFVNGHGGNVEALAEVARRFSRDDGHDGYAVAFTWFEAVGEHAGDMGHAGPLET
27250|hp|hbo       HGFDRVVVVNGHGGNTDALREVTGTITRED--DAYAVAFTWFEAVGEHSSKMGHGGPLET
1759|hp|hwa        HGWDHVVIVNGHGGNIPALEAVTAQIIRHD--NAYAVPFTWFEAIGEHTSSMGHAGPIET
7317|hp|hma        HGWDHVVLVNGHGGNIDALREVAGTITRHD--EAFAVPFTWFNAVGDHSADMGHGGPLET
5235|gene|hhi      HGWDHVVLVNGHGGNIDALREVSGKITRHD--EAFAVPFTWFDAVGDHSADMGHGGPLET
                   ** :.**.*******  .*  *   : * .  :.:** :***:*:.    .:**.** **

1831|gene|hut      SVLEEVAPDLIDEEKMETAREEAAERWGEWTGGVNLAYDVEEFAPNGVVGDPTVADAERG
414|hp|nph         AVMRHLHPELVREDRTDTAAEGAADSWGEWVSGTNLAVDSSSFTESGAVGDPREGDADLG
124|chp|nrc1       AFLRHTDPELIREDRVQAAAEDGADAWGKWVSHANLAADAAAFTDNGVVGDPRAGDADRG
80|gene|hla        ALLRATNPDLVREDRIEAAREGAADRWGEWVSGVNLAHDSDEFSDNGVVGDPTAGDAERG
27250|hp|hbo       ALLRHVAPESVREERIETAREGGADRWGDWVSKVNLAHDSAEFTANGVVGDPSAGDAELG
1759|hp|hwa        SLLERTRPESVHTDRLTDAAAGASDRWGDWQGSVNLAVDSTEFTENGVVGDPREASAELG
7317|hp|hma        SLLQHTNPETVHEDRLDEAADGGSDGWGEWQSGVNLAFDSDEFTQNGVVGDPREGSAERG
5235|gene|hhi      SLLRHMNPETVHEDRLDEAADGGSDGWGEWQSGVNLAFDSDEFTENGVVGDPREGSAERG
                   :.:    *: :  :.   *   .:: **.* . .*** *   *: .*.****  ..*: *

1831|gene|hut      EKLLRSARDELVTLLEDVAERDR----PKA
414|hp|nph         EELFEKAAAALVELLDAVERRSLA------
124|chp|nrc1       AALLDAATESLCALLAAVADRDTTAPLPHR
80|gene|hla        EVLLDLASDALAELTAAVVDRKSV------
27250|hp|hbo       EELLELASASLARLAAAVAERDVSRPARRE
1759|hp|hwa        AELLTAATDELCSLLDAVRSHDAA---PRE
7317|hp|hma        EMLLDLATESLVALLDEIADRPVG---PRE
5235|gene|hhi      ETLLELATESLVDLLDEIADRPAG---PRE
                     *:  *   *  *   :  .