HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0608COG0695KOG1752arCOG02606Glutaredoxin and related proteinshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0608 nrc1 VNG2115 vng2115 no entry
cHOG0608 hmu HMUK0847 Hmuk_0847 glutaredoxin
cHOG0608 hma RRNAC2520 gstN glutathione S-transferase domain-containing protein
cHOG0608 hwa HQ3059A grx glutaredoxin
cHOG0608 hla HLAC0256 Hlac_256 glutaredoxin
cHOG0608 hbo HBOR28340 Hbor_28340 glutathione S-transferase
cHOG0608 hut HUTA1787 Huta_1787 glutaredoxin
cHOG0608 hvo HVO_0337 HVO_0337 glutathione S-transferase N-terminal domain
cHOG0608 nph NP1250A glx_1 glutaredoxin
cHOG0608 hhi 2950 gst2 glutathione S-transferase domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2115|hp|nrc1        ---MSLELYKLPGCPYCAKVETKLDELGLDYVEHEVPSSHSDRDAVESVSGQTGVPVLVD
1787|gene|hut       --MPNLELYELDGCPFCAKVTKKLDDLDLEYESHMVPSAKSARDEVEAVSGQRGVPVLVD
256|gene|hla        MVMTDLTLYELEGCPYCAKVKAKLADLDLEYESVMVPRSHGKRTEVEEISGQTGVPVLVD
3059|gene|hwa       -MMSNLTLYELSGCPYCAKVIDKLDELGLEYDSVSVPRAHSERTEVESISNQTGVPVLVD
12520|gene|hma      --MANLELYELEGCPYCAKVTKKLDELGLDYESHMVPRPHGERTEVKEVSGQTGVPVLID
2950|gene|hhi       --MANLELYELEGCPYCAKVIKKLDELGLDYESHMVPRSHGDRTEVKEVSGQTGVPVLVD
1250|gene|nph       --MANITLYELAGCPYCKKVIDKLDELGLDYDSIEVPRSHSDRTEVEDVSGQTGVPVIID
28340|gene|hbo      --MANLTLYELDGCPYCAKVTDKLAELGLEYDSIMVPRSHSERTEVKEVSGQTGVPVLVD
                        .: **:* ***:* **  ** :*.*:* .  ** .:. *  *: :*.* ****::*

2115|hp|nrc1        PDHDIDGMPESDDIVAHLEQHYAE--
1787|gene|hut       NDNGVEGMPESDDIVDYLEETYGSGE
256|gene|hla        EEHGIDAMPESDDIVEYLEETYGDAS
3059|gene|hwa       EANDVSGMPESDDIVAYLEKTYAN--
12520|gene|hma      EDNGVDGMPESDDIVEYLEKTYGQ--
2950|gene|hhi       EDNGVDGMPESDDIVEYLEETYGQ--
1250|gene|nph       EEHGIEGMPESDDIVEYLEETYGS--
28340|gene|hbo      EEHDVEGMPESDDIVAYLEETYGN--
                      :.:..******** :**: *..