HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0607COG3277KOG3262arCOG02466RNA-binding protein involved in rRNA processinghypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0607 nrc1 VNG1366 vng1366 no entry
cHOG0607 hmu HMUK2789 Hmuk_2789 H/ACA RNA-protein complex component Gar1
cHOG0607 hma RRNAC0040 H/ACA RNA-protein complex component Gar1
cHOG0607 hwa HQ1504A gar1 H/ACA RNA-protein complex component Gar1
cHOG0607 hla HLAC0716 Hlac_716 H/ACA RNA-protein complex component Gar1
cHOG0607 hbo HBOR22960 Hbor_22960 snoRNP protein GAR1
cHOG0607 hut HUTA2506 Huta_2506 H/ACA RNA-protein complex component Gar1
cHOG0607 hvo HVO_1108 HVO_1108 GAR snoRNP component Gar1 homolog
cHOG0607 nph NP3810A H/ACA RNA-protein complex component Gar1
cHOG0607 hhi 800 gar1 H/ACA RNA-protein complex component Gar1
MUSCLE (3.6) multiple sequence alignment


1504|gene|hwa       --MQRLGIVTQHVQHLLIARCDSNMKSPPSIGAHAIDESLSTVGRVVDVFGPTSQPYIAI
2506|gene|hut       --MRRAGEVRGIAQSVAVVQCPD--ETHPDIGTSVIDDSLATVGRVVDVFGPVERPYLAV
10040|gene|hma      --MKRIGTVSRVAQGLAVVRAPD--DEYASVGTTVVDEELQTVGSVVDVFGPVERPYLAV
800|gene|hhi        --MKRIGTVSRVAQGLAVVRAPD--DEYASVGTDVVDEELQTVGSVVDVFGPVERPYLAV
1366|hp|nrc1        --MERAGSVTRTAGTIAVVRTDA--DAHPPIGAMLVDQQLDTVGRVVDVFGPVERPYLAV
3810|gene|nph       --MKRAGEVVRIAQGLLVARLADGDDDPPDIGTSVVNEELDSVGRIVDVFGPVDRPYVAV
22960|gene|hbo      MAMQRVGTVSRTAQNLAIARCEG--EEHPDIGREVVDESLSSVGRVVDVFGPVSRPYVAV
716|gene|hla        --MRRVGTVVRTAGGLAIARTEAG-AEPPRIGSSVVDESLATVGRVVDVFGPVDRPYVAV
                      * * * *   .  : :..        . :*   :::.* :** :******...**:*:

1504|gene|hwa       TPVETCSPAAILGEKIYAK
2506|gene|hut       SPVDSVHPPALVGQPLYYR
10040|gene|hma      SPSDTVHLPALVGAVLYAR
800|gene|hhi        SPNDSVHLPALVGTVLYAR
1366|hp|nrc1        SPDDGVHLPGLVGDTLYKR
3810|gene|nph       SPADDVVPPSLLGEKLYAR
22960|gene|hbo      STSGRATPASLVGTKLYAR
716|gene|hla        TPNDD-DLAALVGGKLYAR
                    :.      ..::*  :* .