HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0606COG1901arCOG01239Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0606 nrc1 VNG1980 vng1980 no entry
cHOG0606 hmu HMUK1447 Hmuk_1447 protein of unknown function DUF358
cHOG0606 hma RRNAC3253 hypothetical protein
cHOG0606 hwa HQ3089A hypothetical protein
cHOG0606 hla HLAC1588 Hlac_1588 protein of unknown function DUF358
cHOG0606 hbo HBOR05920 Hbor_05920 uncharacterized conserved protein
cHOG0606 hut HUTA1107 Huta_1107 protein of unknown function DUF358
cHOG0606 hvo HVO_1989 HVO_1989 Uncharacterized conserved protein
cHOG0606 nph NP2324A hypothetical protein
cHOG0606 hhi 499 HAH_0499 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1980|chp|nrc1      MRQFVVLGHDAPTTPD-FPLDDLPGAAGRLDVLCRCVSAALFVSHGIRDDVEVFLVLGDE
1588|gene|hla      MRQFVVIGHDVPTDPDAISLSDIPG-AGRLDLLCRCVAAGVFLSHGIRERVRVHLVVADE
3089|hp|hwa        MRRTGGF-------PN---LDDLAGGAGRLDILCRCVTSALACSHGIREDVRVHLVLNNQ
2324|hp|nph        MRQFIVIGHDVPTDPDAVSLADLPG-AGRLDVLCRCLNSAFFLSHDLRDNVRVWLVVGDE
1107|hp|hut        MRQFVVIGHEAPTTPD-FPLEDLPGAAGRLDLLSRSITAAFLRSHGLREDVRFRLILGDE
5920|hp|hbo        MRQFVIIGHDAPTTPE-FSLDDLAGGAGRLDVLCRCVNSAFFLSHAIRESVRVHLVLGDE
13253|hp|hma       MRQFVIIGHDAPTTPE-FSLDDLAGAAGRLDVLCRCVTSAFFLSHAIREDVRVHLILGDE
499|hp|hhi         MRQFVIIGHDAPTTPE-FSLDDLAGAAGRLDVLCRCVTSAFFLSHAIREDVRVHLILADE
                   **.   :       *:   * *:.* *****:*.*.: :..  ** :*: * . *:: ::

1980|chp|nrc1      VTVRIDAGAVQYMHPDERNVAGLLKQALDAKTEAIGHQEASSSPGIHVSKRGFEAVLDAV
1588|gene|hla      FTVTFDADSLRHLHPDERNVAARIRDALDAQDDAIGHMPADVSPGVELRRMGLEATLDRV
3089|hp|hwa        FTVQFDGANLKRLNPDERSTAALIRTALENREKAIGHMPAESTPGVSIRRMGFAETVNRL
2324|hp|nph        YAIRFEGSELRRLNPDERSTAALVRGALAAREKAIGSMAANPSPGVYIRTQSLSGLLESV
1107|hp|hut        FTLRFEGAKLQGLNPDERSTAARVRSALEQREGAIGHQAVETSPGIYLARRGVEAALRDA
5920|hp|hbo        FTVRFEGAELRRLNPDERSTAALIRGALDVREEAIGHMPAEASPGVSIRRMGFDATLDAV
13253|hp|hma       YTVTFEGSDLRRLNPDERSTAALIRKALEEREEAIGHIPVETSPGVSLTRRGFEGTLDDV
499|hp|hhi         YTVTFEGSDLRRLNPDERSTAALIRKALEEREEAIGHIPVETSPGVSLTRRGFEGTLDDA
                    :: ::.  :. ::****..*. :. **  .  ***   .. :**: :   ..   :   

1980|chp|nrc1      -----------SGPVVALHEDGDALAAVDPLADPVFVLSDHRDFTAAEASLLADASDHRV
1588|gene|hla      LDTPGTSSASADPTLVQLHEDGDPLVDAAPPTDPVFVLSDHNDFAPAERDLLADRAERRV
3089|hp|hwa        ---------KTETTPIQLHETGTPIVDIDPPDDPLFVLSDHHSLTNDEIEQLGDIAEHQI
2324|hp|nph        ---------ADDGPLVTLHEDGQPVVDIDPSAEPTFVLSDHHSFDDAETALLAAHADRRV
1107|hp|hut        ---------AEEGTLLQLHEDGRPIVERAVPDDPVFVLSDHRDFTEEEQALLDELNAERV
5920|hp|hbo        ---------ATDGTVIELHENGDPVADVEPPEDPVFVLSDHHDFTDDEAAALADAADERV
13253|hp|hma       ---------ARRGTVVQLHEDGDPIVGVAPPSDPVFVLSDHHDFRDEEAALLADRADERV
499|hp|hhi         ---------ASRGTVVQLHEDGDPIVDVAPPSDPVFVLSDHHDFRDEEATLLADRADERV
                                . : *** * .:.      :* ******..:   *   *      .:

1980|chp|nrc1      RVGPTVLHADHAITVAHNHLDTAGFDAY
1588|gene|hla      RVGPELLHADHTVSVVHNWLDTDGYESY
3089|hp|hwa        RLGPMILHADHAITIAHNYLDTNGYNQY
2324|hp|nph        SLGPEPLHADHAITVAHNYLDTDGYNRY
1107|hp|hut        SLGPNAIHADHAISVVHNYLDTDGYERY
5920|hp|hbo        RLGPEVLHADHSITVAHNYLDTDGFSSY
13253|hp|hma       SLGPKALHADHSITVAHNYLDTAGFERY
499|hp|hhi         SLGPKALHADHSITVAHNYLDTDGFEQY
                    :**  :****::::.** *** *:. *