HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0604COG1469arCOG04301Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0604 nrc1 VNG1901 vng1901 no entry
cHOG0604 hmu HMUK1583 Hmuk_1583 GTP cyclohydrolase MptA (EC 3.5.4.-)
cHOG0604 hma RRNAC3309 GTP cyclohydrolase
cHOG0604 hwa HQ3317A GTP cyclohydrolase
cHOG0604 hla HLAC2276 Hlac_2276 protein of unknown function DUF198
cHOG0604 hbo HBOR07600 Hbor_07600 GTP cyclohydrolase MptA
cHOG0604 hut HUTA2260 Huta_2260 GTP cyclohydrolase MptA (EC 3.5.4.-)
cHOG0604 hvo HVO_2348 HVO_2348 conserved hypothetical protein TIGR00294
cHOG0604 nph NP2514A GTP cyclohydrolase
cHOG0604 hhi 546 mptA GTP cyclohydrolase MptA
MUSCLE (3.6) multiple sequence alignment


1901|chp|nrc1       MSQQLPDVQATEPDVSVGLSEVGVTGVEKLVEIAREDDRPIVLMAEFEVYVDLPRGRKGI
2514|gene|nph       MSQQLPDVQASSPDVSVGLSRVGVTGVEKLVKLHRPNDRPIVLMAEFDVFVDLPSWRKGA
2260|gene|hut       MSKQLPDVQANSPEVAVGLNRVGVTGVEKLVEIDREDRRPIVLMATFDVFVDLPTWRKGA
13309|gene|hma      MSQQLPDVQASSPDVTVGLNRVGVTGVEKLVKLGRRDRDPIVLMAEFEVFVDLPSWRKGA
546|gene|hhi        MSQQLPDVQASSPDVTVGLNRVGVTGVEKLVKLGRRDRDPIVLMAEFEVFVDLPSWRKGA
2276|gene|hla       MSHQLPDVQASAPDVSVGLSQVGVTGVEKLVKIARGDKRPIVLMAEFEVFVDLPSGRKGI
3317|gene|hwa       MSHQLPDIQASRPDVTVGLSQVGVTDVDKLVKIERDGETPLVLMAEFEVFVDLPSGRKGI
7600|gene|hbo       MSHQLPDVQASRPDVTVGLSQVGVTGVDKLVKIARDGKRPLILMAEFEVFVDLPSGRKGI
                    **:****:**. *:*:***. ****.*:***:: * .  *::*** *:*:****  *** 

1901|chp|nrc1       DMSRNMRVIDETLEDAVREPIYRVEEMCGEVAERLLEKHDYTTTATVEMNAELMLREETP
2514|gene|nph       DMSRNMEVVDEMLEEAVSEPALSVEDVCGDVAERLIEKHDYTTQAEVRMEAEYMIREETP
2260|gene|hut       DMSRNMEVIDETLEAAVDNTGYRVEDVCGDAAERLLDKHDYTDRAEVRMEAEYVTRERTP
13309|gene|hma      DMSRNMEVIDETLETAVSEEAYRVEDVCGDAAELLLEKHDYTTKAEVRMEAEYVTHESTP
546|gene|hhi        DMSRNMEVIDETLETAVSEEAYRVEDVCGDAAELLLEKHDYTTKAEVRMEAEYVTHESTP
2276|gene|hla       DMSRNLATIDEILEEITREEAYRVEEVCGDAAERLLEKHDYTTTAEVSMSAELVTREDTP
3317|gene|hwa       DMSRNMQVIDETLEAAVSGSVSRVEDMCGDVAERLLEKHEYTTTATVEMTADLVMHEDTP
7600|gene|hbo       DMSRNMQVIDEILEDAVAEPTYRVEDMCGDTAERLLAKHDYTSKAEVRMTAELVLREDTP
                    *****: .:** **  .      **::**:.** *: **:**  * * * *: : .* **

1901|chp|nrc1       ASDLPTQGTIDIIASATAQEDAPTREEIGARVVGMTVCPCSQQMMSETARRKLAELGVGE
2514|gene|nph       ATDRPTQATADIIASATADEDGNTREEIGCHVVGMTVCPCSQGMSESRARDVLEGLDVDR
2260|gene|hut       ESDRPTQSTADIIASATATDEG-TREELGARVTGMTVCPCSQGMSESRARQTLNDLDVDR
13309|gene|hma      ASEMATQSTADIIASATATEDG-TSEEIGARVTGMTVCPCSQGMSASRARETLKQLNVED
546|gene|hhi        ASGMPTQSTADIIASATATEDG-TSEEIGARVTGMTVCPCSQGMSASRARETLQQLDVDD
2276|gene|hla       ASGIETQSTATIVASATATEED-TREEIGAEVTGMTVCPCSQGMSESRAREKLADLGVDE
3317|gene|hwa       ASELPTQNTISILASATATDEG-TREEIGAEVIGMTVCPCSQGMSASRARDVMHDLDIED
7600|gene|hbo       ASELQTQSTANIIASAVATEDG-TREEIGAEVVGMTVCPCSQGMSASRARDVLRDLDVED
                     :   ** *  *:***.* ::  * **:*. * ********* *  . **  :  *.:  

1901|chp|nrc1       DAVREFLRDVPQAGHSQRGHATLTVEAGGDPDVNLMDLVSVARDSMSARIYNTAKRPDED
2514|gene|nph       DTIDAFLEEVPQPGHSQRGHATLTVETSGDPDVDLRTLIDIARDSMSARIYNLAKRPDED
2260|gene|hut       ETIDTFLDEVPQAGHSQRGHATLTIESDGSPDVDLRDVIAVARDAMSAHIYNLAKRPDED
13309|gene|hma      DVIEEFLETNPQAGHSQRGHATLTVQSDGAPEVDLNELIEVARDSMSARIYNLAKRPDED
546|gene|hhi        DVIEDFLETIPQAGHSQRGHATLTVQSDGAPEVDLNELIEVARDSMSARIYNLAKRPDED
2276|gene|hla       ETTEEFLEAVPQPGHSQRGHATLTVTTDGHPDIDLRDLIDVARDSMSARIYNMAKRPDED
3317|gene|hwa       ETIETFLEQVPQPGHSQRGHATLTVTADGSPDVDLIELADIARDAMSARIYNLAKRPDED
7600|gene|hbo       ETIEEFLEQVPQPGHSQRGHATLTVETEGSPDVDLIDIVDIARDSMSARIYNLAKRPDED
                    :.   **   **.***********: : * *:::*  :  :***:***.*** *******

1901|chp|nrc1       HMTYESHANAKFVEDCVRSMARGVVEEFDHLPEDAVVTMKQSNDESIHQHNAHAERVAEF
2514|gene|nph       HMTFESHSDAKFVEDCVRSMANGLLEEYPDLPDDTIVRMEQSNDESIHQHNAHAERVAEF
2260|gene|hut       HMTYEAHADAKFVEDCVRSLAEGVVETFPDLPENAVIRMEQSNDESIHQHNAHAERVARF
13309|gene|hma      HMTYEAHKDAKFVEDCVRALAEGVVNTFPDLPDDAVVTMKQSNDESIHQHNAHAERVAQL
546|gene|hhi        HMTYEAHKDAKFVEDCVRALAEGVVETFPDLPDDAVVTMKQSNDESIHQHNAHAERVAQL
2276|gene|hla       HMTYEAHADAKFVEDCVRALAEGTIEEFGHLSDDAVIHMKQSNDESIHQHNAHAEREVTM
3317|gene|hwa       YMTYHAHADAKFVEDCVRSMAEQVVNSFEHLDDDAVVRMKQSNDESIHQHNAHAEREVTL
7600|gene|hbo       HMTYHAHANAKFVEDCVRSMADQVLTEFDHLADDAVVHMKQSNDESIHQHNAHAERVASL
                    :**: :* :*********::*   :  :  * ::::: *:**************** . :

1901|chp|nrc1       GQLREEVGSGE------------------------------
2514|gene|nph       GQLRREVRD--------------------------------
2260|gene|hut       GDLTDEVNGDAEGGNPEPADSGVAGTETDAVDRRTNGSGDR
13309|gene|hma      DDLRQEVSED-------------------------------
546|gene|hhi        GDLRQEVSEDSED----------------------------
2276|gene|hla       GDLRDELDAE-------------------------------
3317|gene|hwa       EQLRAEVSAS-------------------------------
7600|gene|hbo       GELRDELEERD------------------------------
                     :*  *: