HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0603COG1661arCOG04212Predicted DNA-binding protein with PD1-like DNA-binding motifhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0603 nrc1 VNG2339 vng2339 no entry
cHOG0603 hmu HMUK0764 Hmuk_0764 protein of unknown function DUF296
cHOG0603 hma RRNAC2689 hypothetical protein
cHOG0603 hwa HQ3460A polA operon protein ( DNA-binding protein)
cHOG0603 hla HLAC0149 Hlac_149 protein of unknown function DUF296
cHOG0603 hbo HBOR01610 Hbor_01610 predicted DNA-binding protein with PD1-like DNA- binding motif
cHOG0603 hut HUTA1618 Huta_1618 protein of unknown function DUF296
cHOG0603 hvo HVO_0064 HVO_0064 predicted DNA-binding proteins with PD1-like DNA-binding mot
cHOG0603 nph NP0478A polA operon protein ( DNA-binding protein)
cHOG0603 hhi 3091 HAH_3091 polA operon protein ( DNA-binding protein)
MUSCLE (3.6) multiple sequence alignment


1618|hp|hut        MHYRELTGSREFVASLTHGEDWRGQIEAFARDEGIKAAVFFGLGTVQDAAIWYYDQDEQT
478|gene|nph       MDYQRVEGDREYVARLEHGRDWREQIEAFAAEEDIDAAFFLGLGAVQDATVYFYDQVEQE
2339|chp|nrc1      MNAREVTGGREFVVRLDPGSEWRTELETLAATEDITAAWFTGLGAVQDAELWYYDQDDFE
12689|hp|hma       MDYREVDSTSEFVCRLEHGGDWRAQIEAFADEQGIDAGFFYGLGAVQDAELMFYDQDRTE
3091|gene|hhi      MDYREVDSTSEYVCRLAHGADWRGEIEAFADEQGIDAGFFYGLGAVQDAELMFYDQDRTE
149|gene|hla       MHHREVESTAEYVARFETGADWREEIEDLARAEDVEAGWFTALGAVQDAEVWFYDQDETE
3460|gene|hwa      MHYREVDTTQEFLLRLETGADWRTEIEEFAELKNIDAAWFNAMGAVQDAEVWFYDHTETE
1610|hp|hbo        MNYRAVESSREFLVSLDNGADWREEIEEFAHLEDIESAWFNAMGAVQDADVWFYDQDDQA
                   *  . :    *::  :  * :** ::* :*  :.: :. * .:*:**** : :**:    

1618|hp|hut        YRETVFDEPLEVAACVGNISLDVDGEPFAHTHVVLSREDGSTIAGHLDAGTTYIGELYVR
478|gene|nph       YYPVEFDEPFEVTTALGNISH-LDGERFAHTHVTLSREDGSMVGGHLDSATTFAGELYVR
2339|chp|nrc1      YTAAEFDEPLEVAACVGNIAT-LDGEPFAHTHATLSRRSGQALAGHLERATVFAGELYVR
12689|hp|hma       YDSLTFDEPLEVAACMGNISH-FDGERFAHTHAVLSRPDGEAVAGHLNAGTVWAGELYVR
3091|gene|hhi      YDSVTFDEPLEVAACMGNISQ-LDGERFAHTHAVLSRPDGEAIAGHLNAGTVWAGELYVR
149|gene|hla       YQSVTFDEPLEVAACVGNVSL-LDGDVFAHTHVVLSRPSGQALAGHLDSATVWAGECHLR
3460|gene|hwa      YNSVNFDEPLEIAACIGNISM-LDDERFAHTHAVLSRPSGQALAGHLNAGTVFAGEVYLR
1610|hp|hbo        YRSVTFDEPLEVAACVGNIAL-LDDEPFAHTHAVLSRPSGQSLAGHLNAATVFAGEVYIR
                   *    ****:*:::.:**::  .*.: *****..*** .*. :.***: .*.: ** ::*

1618|hp|hut        TFEESLERAPDETTGGDLWAL
478|gene|nph       TFDAHLEREHDETTDLDLWPL
2339|chp|nrc1      ELDADLVREHDAATDLDRW-L
12689|hp|hma       GFDTELQREHDEPTDLDLWNI
3091|gene|hhi      GFDTELKREHDEPTDLDLWNI
149|gene|hla       AFAEPLERSHDAATDLDLW-L
3460|gene|hwa      VLDTDLVREYDETTGLDVW-L
1610|hp|hbo        AFDEPLEREHDDVTDLDLW-L
                    :   * *  *  *. * * :