HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0602COG0622KOG3325arCOG01141Predicted phosphoesterasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0602 nrc1 VNG2444 vng2444 no entry
cHOG0602 hmu HMUK0825 Hmuk_0825 phosphodiesterase, MJ0936 family
cHOG0602 hma RRNAC2722 yhcR3 phosphoesterase
cHOG0602 hwa HQ3640A phosphoesterase,metallo-phosphoesterase-calcineu rin-like
cHOG0602 hla HLAC0329 Hlac_329 phosphodiesterase, MJ0936 family
cHOG0602 hbo HBOR29440 Hbor_29440 phosphoesterase, MJ0936 family
cHOG0602 hut HUTA1836 Huta_1836 phosphodiesterase, MJ0936 family
cHOG0602 hvo HVO_0245 HVO_0245 phosphoesterase
cHOG0602 nph NP0462A hypothetical protein
cHOG0602 hhi 11 yhcR1 phosphoesterase
MUSCLE (3.6) multiple sequence alignment


1836|gene|hut       --------------------------------MIAVFADTHGTDDLQLAGRAANALADAE
2444|chp|nrc1       MAYSGPPKHHAQPSGPHHRPQRSHAPTHYATPMIAVLADTHSDTDHALTGHARQAVADAD
329|gene|hla        --------------------------------MLVVVSDTHSREESKLQGRTAEAVREAD
3640|gene|hwa       --------------------------------MLTVISDTHSTDNHQLSGQTYEAVQNAE
29440|gene|hbo      --------------------------------MLTVVSDTHSTDSHRLSGRTLEAVREAE
462|hp|nph          --------------------------------MLAVLSDTHGRDSPRLSGRTADAVAEAS
12722|gene|hma      ----------------MTQNASGFIPGSTTGSMLTAISDTHGTDNHRLTGRTLDAVREAD
11|gene|hhi         --------------------------------MLTVISDTHGTDDHRLSGRTLDAVREAD
                                                    *:...:***.  .  * *.: :*: :*.

1836|gene|hut       RVLHAGDFTTAAVYEAFEARTSELIAVHGNSDAAPLRDRLPAVETIEWNDRELLLIHGHE
2444|chp|nrc1       AVVHAGDFTTESSLDAFHDAATRLHAVHGNADSPAVRDRLPPARTITTAGLRIALTHREP
329|gene|hla        VVVHAGDFYREPVLNAFESATRSLRAVYGNNDDAGIRDRVPEVRTVEYAGVRFAVTHRHR
3640|gene|hwa       MVAHAGDFMCESVLDALQREATQLVGVAGNNDDTGIRERLPTTRQFTFAGVQFVMTHTRR
29440|gene|hbo      LVVHLGDFMRESVLDAFESESSQLFGVYGNNDDAGIRDRLPDTRTFTFAGLTFAATHTRR
462|hp|nph          RVVHAGDFMTEAVLDAFE-ERGPLAAVYGNNATAAVRERLPAERIVVWEGLRIAVVHGHE
12722|gene|hma      HVLHAGDFMTEQVLDAIDAESDELTGVVGNNDRPAVRARLSDVATVSWEELTIVVVHGHE
11|gene|hhi         HVLHAGDFMTERVLDAIDAECDELTGVVGNNDRPAVRARLPDVATVSWEGLTIVVVHGHE
                     * * ***      :*:      * .* **   . :* *:.    .      :   *   

1836|gene|hut       HTPTSLPLLARERGADLVITGHTHRPAIERLGDLHVLNPGSHTDPRASAPSYAELRQE-T
2444|chp|nrc1       GGDTALSLFGRERGADIVVSGHTHTPTLTTTPTAVLLNPGSHADPRGSPAAHATLHPTDH
329|gene|hla        NGDTGLVMLARERDADAVICGHSHRPRFDDDGALPILNPGSHAQPRGNRPAHAELEPASE
3640|gene|hwa       GGPTALSLLGRERDADVVIFGHSHRPTVIESEECTLVNPGSHAQPRGHRAAHAEFDPQPT
29440|gene|hbo      GGSTALSMFGRERGADVVLFGHSHRPTFDGTGEVTLLNPGSHAQPRGHRTAHAELEPMTD
462|hp|nph          HTETALAMFGRQSSADLVVFGHSHEPTFED-GTVPMLNPGSHADPRWHRPAHAELEWD-D
12722|gene|hma      HTETALGMLARQENADIVVVGHSHKPVLTDFGGWTLVNPGSYADPRRYQPAHAELDVM-A
11|gene|hhi         HTETALGMLARQENADIVVVGHSHKPVLTDFGGWTLVNPGSYADPRRYQPAHAELDVM-A
                       *.* ::.*: .** *: **:* * .       ::****:::**   .::* :     

1836|gene|hut       GD--VVIELREPTGKIIERRRVAGE--
2444|chp|nrc1       G---VRIAISTRDGDTIRSTHVSRD--
329|gene|hla        GESTLNGRLVTPDGQIFGEFQIAP---
3640|gene|hwa       GE--LNGRLITVDGDVFESFTITN---
29440|gene|hbo      GG--VRGRLVTVEGDVFETFTIPSTEN
462|hp|nph          DEQVARGQLVEPAGEVFERFTVEPRRP
12722|gene|hma      GD--VRVRLRSPDGTPISTTIVER---
11|gene|hhi         GD--VRVRLRSPDGTPISTTIVER---
                    .       :    *  :    :