HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0601COG0221KOG1626arCOG01711Inorganic pyrophosphataseinorganic pyrophosphatase

HOG Organism Gene ID Name Annotation
cHOG0601 nrc1 VNG0259 ipp inorganic pyrophosphatase
cHOG0601 hmu HMUK3063 Hmuk_3063 Inorganic diphosphatase( EC:3.6.1.1 )
cHOG0601 hma RRNAC3323 ipp inorganic pyrophosphatase
cHOG0601 hwa HQ1231A ipp inorganic pyrophosphatase
cHOG0601 hla HLAC0304 Hlac_304 Inorganic pyrophosphatase
cHOG0601 hbo HBOR24860 Hbor_24860 inorganic pyrophosphatase( EC:3.6.1.1 )
cHOG0601 hut HUTA1204 Huta_1204 Inorganic diphosphatase
cHOG0601 hvo HVO_0729 HVO_0729 ppa inorganic pyrophosphatase
cHOG0601 nph NP5192A ipp inorganic pyrophosphatase
cHOG0601 hhi 563 ppa inorganic pyrophosphatase
MUSCLE (3.6) multiple sequence alignment


1204|gene|hut       ----------------MVNLFEALEAGPNPPEEIYAVVECLKGERNKYEYDKDLPGVVLD
5192|gene|nph       --------------MAGANLWEDLETGPNAPEEIYAVVECLKGERNKYEYDKDIPGVMLD
304|gene|hla        ----------------MVNLWEDLETGPNAPDEIYAVVECLKGERNKYEYDKDIPSVVLD
13323|gene|hma      ----------------MTNLWEDLETGPNPPEEIYAVVECLKGERNKYEYEKDIPGVVLD
563|gene|hhi        MAITKGFFDGVAQSPVMTNLWEDLETGPNPPEEIYAVVECLKGERNKYEYEKDIPGVVLD
1231|gene|hwa       ----------------MSNLWTDLETGPDAPDVVYAVIECLKGERNKYEYDKDVPGVVLD
259|gene|nrc1       ----------------MANLWEDLETGPDAPDVIYAVVECLKGERNKYEYDKDIPGVVLD
24860|gene|hbo      ----------------MTNLWEDMETGPDAPDVVYAVVECLKGERNKYEYDKDIPGVVLD
                                      **:  :*:**:.*: :***:************:**:*.*:**

1204|gene|hut       RVLHSNVHYPSDYGFIPQSHYDDDDPLDVLVLVEDQTFPGCVIEARPVALMKMDDDGEQD
5192|gene|nph       RVLHSNVHYPGDYGFIPQSYYDDEDPFDVLVLVEDQTFPGCIIEARPVALMKMDDDGEQD
304|gene|hla        RVLHSNVHYPYDYGFIPQSYYDDEDPFDVMVLVEDQTFPGCVIEARPVALMKMDDDGEQD
13323|gene|hma      RVLHSNVHYPSDYGFIPQSYYDDEDPFDVLVLVEDQTFPGCVIEARPVALMKMDDDGEQD
563|gene|hhi        RVLHSNVHYPSDYGFIPQSYYDDEDPFDVLVLVEDQTFPGCVIEARPVALMKMDDDGEQD
1231|gene|hwa       RVLHSNVHYPSDYGFLPQTYYDDEDPFDIMVLVEDQTFPGCIIEARPVALMRMDDDGEKD
259|gene|nrc1       RVLHSNVHYPSDYGFIPQSYYDDGDPFDVLVLVEDQTFPGCVIEARPVALMEMDDDGEQD
24860|gene|hbo      RVLHSNVHYPSDYGFMPQTYYDDEDPFDILVLVEDQTFPGCVIEARPVALMGMDDDGEKD
                    ********** ****:**::*** **:*::***********:********* ******:*

1204|gene|hut       DKVIAVPTEDPRYDHIEDLEDIPSQQLDEIDEFFETYKNLEEGKEVETLGWEDAAAARDA
5192|gene|nph       DKVIAVPSEDPRYDHIEDLEDIPQQTLDEIDEFFETYKNLEEGKEVETQGWEDKQAAFDA
304|gene|hla        DKVIAVPTEDPRFDHIEDLSDLPQQTLDEIDEFFSTYKNLEAGKEVETLGWEDKQAARDA
13323|gene|hma      DKVIAVPTEDPRYDHIEDLDDMPQQTLDEIDEFFSTYKNLEEGKEVETLGWEDKEAAKDA
563|gene|hhi        DKVIAVPIEDPRYDHIEDLDDIPQQTLDEIDEFFSTYKNLEEGKEVETLGWEDKEAAKDA
1231|gene|hwa       DKVIAVPDEDPRYDHVEDLDDLTDQTTAEIAEFFETYKNLETGKQTETLGWESADAATDA
259|gene|nrc1       DKVIAVPEEDPRYDDVEDVDDLTDQQKAEIAEFFETYKNLEADKETAVLGWGDAQAAKDA
24860|gene|hbo      DKVIAVPTEDPRYDHVQDVDDLTDQQKDEIAEFFETYKNLEAGKEVETLGWEGADAAKDA
                    ******* ****:* ::*:.*:..*   ** ***.****** .*:. . ** .  ** **

1204|gene|hut       IEHSRELYEEKIAE
5192|gene|nph       IEHAQDLYEEHFG-
304|gene|hla        IEHAQDLYDEEFQ-
13323|gene|hma      IVHAQELYDEEFN-
563|gene|hhi        IVHAQELYDEEFN-
1231|gene|hwa       IEHAMELYEEQID-
259|gene|nrc1       IEHAQDLYDEQFA-
24860|gene|hbo      IEHAMDLYDENFA-
                    * *: :**:* :