HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0060arCOG07919hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0060 nrc1 VNG2511 vng2511 no entry
tucHOG0060 hmu HMUK0433 Hmuk_0433 conserved hypothetical protein
tucHOG0060 hma RRNAC2989 hypothetical protein
tucHOG0060 hwa HQ1113A hypothetical protein
tucHOG0060 hla HLAC0867 Hlac_867 hypothetical protein
tucHOG0060 hla HLAC3162b Hlac_3162 hypothetical protein
tucHOG0060 hbo HBOR04440 Hbor_04440 hypothetical protein
tucHOG0060 hut HUTA0178 Huta_0178 hypothetical protein
tucHOG0060 hut HUTA1104 Huta_1104 hypothetical protein
tucHOG0060 hut HUTA1756 Huta_1756 conserved hypothetical protein
tucHOG0060 hut HUTA1964 Huta_1964 conserved hypothetical protein
tucHOG0060 hvo HVO_1785 HVO_1785 conserved hypothetical protein
tucHOG0060 nph NP1150A hypothetical protein
tucHOG0060 hhi 2811 HAH_2811 hypothetical protein
tucHOG0060 hhi 252 HAH_0252 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3162|hp|hla       -----------MVEPDPAPDFDEE----------------------QYQNELNDAVDDGG
4440|hp|hbo       ---------MNSGDYDSEQETDTE----------EDTADVSENDTTDDDYEHLKSLDDGV
1113|hp|hwa       MTGVSSDSDRQIDAIDPEQRIDSDEQDRESEESNVDTASSDAASTSNDESSHLDDLADGA
1756|chp|hut      ----------MTETSETATATTPR--------------------DERSEQDHLEDVEVGA
2511|hp|nrc1      -------------MTDDQHDASEE-------------------------RAHLDDVEDGA
867|hp|hla        ----------MTEHADPQATDDEREGVEADRRGDDVDAEGETDTDPDDGTGHLNDIEDGA
2811|hp|hhi       ----------MTETMSKSKADDPE-------------------------RAHLADVADGC
1104|hp|hut       ----------------MSETDDAD-------------------------YEHLDDVEDGC
178|hp|hut        ------MSDMRQSTADEETTEDAA---------------------QSIEDDHLEDVEDGC
1964|chp|hut      -----------------MSDTDSE-------------------------ADHLDNVEDGC
12989|hp|hma      -----------MTNAQQTHDDDAE--------------------REEPTTDHLDNVEDGC
252|hp|hhi        -----------MTNAQQTHDDDAE--------------------REEPTTDHLDNVEDGC
1150|hp|nph       -----------MTETREENGDDVD-------------------------TSHLDNVEDGC
                                                                         :  * 

3162|hp|hla       GCAETWETLSEAR--DKFTPDRRSVLKGVGALGASAVGVSSLGVATAKEKPGNEEIEVAL
4440|hp|hbo       GCTEIWEHLSESR--DG-------------------------------------------
1113|hp|hwa       GCTEIWEHLSESR--D--------------------------------------------
1756|chp|hut      GCTEIWEHLSENR--GGAAGD---------------------------------------
2511|hp|nrc1      GCTEIWERLSGHR-ADAAEPDR--------------------------------------
867|hp|hla        GCTEIWERLSERR--EE-------------------------------------------
2811|hp|hhi       GCTEIWEHMSEAR--DADDD----------------------------------------
1104|hp|hut       GCAEVWETMSEHR--ESSGDAGVADD----------------------------------
178|hp|hut        GCAEVWEHLSEQR--EDT------------------------------------------
1964|chp|hut      GCAEVWEHLSAER--ERTASDD--------------------------------------
12989|hp|hma      GCTEIWEHMSEERESESASDD---------------------------------------
252|hp|hhi        GCTEIWEHMSEER--ESASDD---------------------------------------
1150|hp|nph       GCTEIWEHMSDER--DDAE-----------------------------------------
                  **:* ** :*  *                                               

3162|hp|hla       NSDAVQALLEELHYPDVRKNAAKKIKPKIQNADEDEELDTDELLSILKLPTKIGDIIYPL
4440|hp|hbo       ------------------------------------------------------------
1113|hp|hwa       ------------------------------------------------------------
1756|chp|hut      ------------------------------------------------------------
2511|hp|nrc1      ------------------------------------------------------------
867|hp|hla        ------------------------------------------------------------
2811|hp|hhi       ------------------------------------------------------------
1104|hp|hut       ------------------------------------------------------------
178|hp|hut        ------------------------------------------------------------
1964|chp|hut      ------------------------------------------------------------
12989|hp|hma      ------------------------------------------------------------
252|hp|hhi        ------------------------------------------------------------
1150|hp|nph       ------------------------------------------------------------
                                                                              

3162|hp|hla       IDQEEGSPVIFRFKGKGTRPGKYNDLPDNVSSGLISDGEDITIVRGATKHEIDVILNATR
4440|hp|hbo       ------------------------------------------------------------
1113|hp|hwa       ------------------------------------------------------------
1756|chp|hut      ------------------------------------------------------------
2511|hp|nrc1      ------------------------------------------------------------
867|hp|hla        ------------------------------------------------------------
2811|hp|hhi       ------------------------------------------------------------
1104|hp|hut       ------------------------------------------------------------
178|hp|hut        ------------------------------------------------------------
1964|chp|hut      ------------------------------------------------------------
12989|hp|hma      ------------------------------------------------------------
252|hp|hhi        ------------------------------------------------------------
1150|hp|nph       ------------------------------------------------------------
                                                                              

3162|hp|hla       FDNKEDLRIVKTSEMNGFRLFKGFEDSSEQSSQQDPDSDLDLQVYEVLLEDREIQYEVQE
4440|hp|hbo       ------------------------------------------------------------
1113|hp|hwa       ------------------------------------------------------------
1756|chp|hut      ------------------------------------------------------------
2511|hp|nrc1      ------------------------------------------------------------
867|hp|hla        ------------------------------------------------------------
2811|hp|hhi       ------------------------------------------------------------
1104|hp|hut       ------------------------------------------------------------
178|hp|hut        ------------------------------------------------------------
1964|chp|hut      ------------------------------------------------------------
12989|hp|hma      ------------------------------------------------------------
252|hp|hhi        ------------------------------------------------------------
1150|hp|nph       ------------------------------------------------------------
                                                                              

3162|hp|hla       LFEDDEPSSDDIEVGEVAIAQQSCLNTCTTCIGIIGGACPACLAFLTFGVPGAVAFIICF
4440|hp|hbo       ------------------------------------------------------------
1113|hp|hwa       ------------------------------------------------------------
1756|chp|hut      ------------------------------------------------------------
2511|hp|nrc1      ------------------------------------------------------------
867|hp|hla        ------------------------------------------------------------
2811|hp|hhi       ------------------------------------------------------------
1104|hp|hut       ------------------------------------------------------------
178|hp|hut        ------------------------------------------------------------
1964|chp|hut      ------------------------------------------------------------
12989|hp|hma      ------------------------------------------------------------
252|hp|hhi        ------------------------------------------------------------
1150|hp|nph       ------------------------------------------------------------
                                                                              

3162|hp|hla       TSVCGITLPVFCGQCLDCGT
4440|hp|hbo       --------------------
1113|hp|hwa       --------------------
1756|chp|hut      --------------------
2511|hp|nrc1      --------------------
867|hp|hla        --------------------
2811|hp|hhi       --------------------
1104|hp|hut       --------------------
178|hp|hut        --------------------
1964|chp|hut      --------------------
12989|hp|hma      --------------------
252|hp|hhi        --------------------
1150|hp|nph       --------------------