HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0598COG0480KOG0469 KOG0465 KOG0467 KOG0468arCOG01559Translation elongation factors (GTPases)translation elongation factor eEF-2

HOG Organism Gene ID Name Annotation
cHOG0598 nrc1 VNG2654 eef2 translation elongation factor eEF-2
cHOG0598 hmu HMUK0504 Hmuk_0504 translation elongation factor aEF-2( EC:3.6.5.3 )
cHOG0598 hma RRNAC2413 fusA elongation factor EF-2
cHOG0598 hwa HQ3388A tef2 elongation factor EF-2
cHOG0598 hla HLAC0152 Hlac_152 translation elongation factor aEF-2
cHOG0598 hbo HBOR28140 Hbor_28140 translation elongation factor 2 (EF-2/EF-G)( EC:3.6.5.3 )
cHOG0598 hut HUTA2874 Huta_2874 translation elongation factor aEF-2
cHOG0598 hvo HVO_0356 HVO_0356 translation elongation factor aEF-2
cHOG0598 nph NP0130A tef2 elongation factor EF-2
cHOG0598 hhi 2846 tef2 translation elongation factor aEF-2
MUSCLE (3.6) multiple sequence alignment


2654|gene|nrc1      MGRRKKIVEQCERLMDNPEQIRNIAIAAHVDHGKTTLTDNLLAGAGMISEDTAGQQLAMD
152|gene|hla        MGRRKKIVQECERLMDEPDNIRNIAIAAHVDHGKTTLSDNLLAGAGMISQDTAGEQLAMD
12413|gene|hma      MGRRKKIVQECETLMDDPEHIRNIAIAAHVDHGKTTLTDNLLAGAGMISDDTAGEQLAMD
2846|gene|hhi       MGRRKKIVQECETLMDDPEHIRNIAIAAHVDHGKTTLTDNLLAGAGMISDDTAGEQLAMD
2874|gene|hut       MGRRKKIVQECETLMDKPENIRNIAIAAHVDHGKTTLTDNLLAGAGMISDETAGEQLAMD
130|gene|nph        MGRRKKIVQECERLMDEPEQIRNIAIAAHVDHGKTTLTDNLLAGAGMISDETAGEQLAMD
3388|gene|hwa       MGRRKKIVQECEQLMDAPGQIRNIAIAAHVDHGKTTLTDNLLAGAGMIADEGEATRLMMD
28140|gene|hbo      MGRRKKIVQECEKLMDKPEQIRNIAIAAHVDHGKTTLTDNLLAGAGMIADEGEATRLMMD
                    ********::** *** * :*****************:**********:::  . .* **

2654|gene|nrc1      TEEDEQERGITIDAANVSMTHEYEGDDHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
152|gene|hla        TKEDEQERGITIDAANVSMTHEYEDTNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
12413|gene|hma      TEEDEQERGITIDAANVSMTHEYEDQNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
2846|gene|hhi       TEEDEQERGITIDAANVSMTHEYEDQNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
2874|gene|hut       TEEDEQERGITIDAANVSMTHEYEDTNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
130|gene|nph        TEEDEQERGITIDAANVSMTHEYEDENHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
3388|gene|hwa       TEEDEQERGITIDAANVSMTHTYEDTNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
28140|gene|hbo      TEEDEQERGITIDAANVSMTHEYEDNNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
                    *:******************* **. :*********************************

2654|gene|nrc1      AVEGAMPQTETVVRQALREGVKPTLFINKVDRLISELQEGPEEMQERLLSVIGDVNELIR
152|gene|hla        AVEGAMPQTETVLRQALREGVKPALFINKVDRLISELQEGPQEMQERLMSVIADVNELIR
12413|gene|hma      AVEGAMPQTETVLRQALREGVKPTLFINKVDRLISELQEGPEEMQKRLLAVIQDVNDLIR
2846|gene|hhi       AVEGAMPQTETVLRQALREGVKPTLFINKVDRLISELQEGPEEMQERLLAVIQDVNDLIR
2874|gene|hut       AVEGAMPQTETVLRQALREGVKPTLFINKVDRLISELQEGPEEMQERLVSVIRDVNELIR
130|gene|nph        AVEGAMPQTETVLRQALREGVKPTLFINKVDRLISELQEGPEEMQQRLTGVIGDVNELIR
3388|gene|hwa       AVEGAMPQTETVVRQALREGVKPALFINKVDRLISELQEGPQEMQERLQTVIADVNELIR
28140|gene|hbo      AVEGAMPQTETVVRQALREGVKPALFINKVDRLISELQEGPEEMQQRLTDVISDVNELIR
                    ************:**********:*****************:***:**  ** ***:***

2654|gene|nrc1      GMTEEKDDI-EDWTVSVEDGTVAFGSALYKWGVSMPSMQRTGMDFGDIIDLERSDKREEL
152|gene|hla        GMAENMDDIPEDWTVSVEDGTVGFGSALYKWGVSMPSMQRTGMDFGDIMDLEQNDKRDEL
12413|gene|hma      GMTEEMDDI-EDWTVSVEEGTVGFGSALYKWGVSMPSMQRTGMDFGEIMELERADNRQEL
2846|gene|hhi       GMTEEMDDI-EDWTVSVEEGTVGFGSALYKWGVSMPSMQRTGMDFGEIMELERNDNRQEL
2874|gene|hut       GMTEEMDDINDDWTVSVEEGTVGFGSALYKWGVSMPSMQRTGMDFGEIMELERADKRQEL
130|gene|nph        GMTEEMDDINEDWTVSVEDGTVGFGSALYKWGVSMPSMQRTGMDFGEIIELERADKRQEL
3388|gene|hwa       GMTENRDDI-NDWTVSVEGGTVAFGSALYKWGVSAPSMIETGIGFPEIIEMEQNDKRKQL
28140|gene|hbo      GMTEDMDDV-DDWTVSVEDGTVAFGSALYKWGVSLPSMQATGMSFGDIIELERADKRQEL
                    **:*: **: :******* ***.*********** ***  **:.* :*:::*. *:*.:*

2654|gene|nrc1      HEQTPLADVVLDMVAEHFPNPIDAQPRRIPTVWRGDADSEIAESMRLVDEDGEVVLMVTD
152|gene|hla        HERTPLSDVVLDMVCEHFPNPVDAQPRRVPRIWRGDAESELADTMRMVNEDGEVVFMVTD
12413|gene|hma      HERTPLSDVVLDMVCEHFPNPVDAQPMRVPRIWRGDAESQLADDMRLVNEDGEVVLMVTD
2846|gene|hhi       HERTPLSDVVLDMVCEHFPNPVDAQPMRVPRIWRGDAESQLAEDMAMVNEDGEVVLMVTD
2874|gene|hut       HERTPLSDVVLDMVCEHFPNPVDAQPRRIPRIWRGDADSEVAEQMQLVDEDGDVVLMVTD
130|gene|nph        HERTPLSDVVLDMVCEHFPNPVDAQPRRIPRIWRGDADSEVAEAMELVNEDGELVMMVTD
3388|gene|hwa       HEETPLSDVVLDMVAEHFPDPLDAQPRRIPRVWRGDDSSNLATQMRDVTDDGDVVFMVTD
28140|gene|hbo      HEKTPLSDVVLDMVAEHFPDPLDAQPRRIPRVWRGDDDTDLAKQMREVDDDGEVVFMVTD
                    ** ***:*******.****:*:**** *:* :**** .:::*  *  * :**::*:****

2654|gene|nrc1      IGVDPHAGEIAAGRVFSGTLEKGQELYVSGTAGKNRVQSVGIYMGGEREEVDE-VPAGNI
152|gene|hla        ISMDPHAGEIATGRVFSGTLEKGQELYVSGTAGKNRIQSVGLFMGSEREEVDR-VPAGNI
12413|gene|hma      IGVDPHAGEIAAGRVFSGTLEKGQELYVSGTAGKNRIQSVGIYMGGEREEVDR-VPAGNI
2846|gene|hhi       IGVDPHAGEIAAGRVFSGTLEKGQELYVSGTAGKNRIQSVGIYMGGEREEVEH-VPAGNI
2874|gene|hut       IGVDPHAGEVAAGRVFSGTIEEGQELYVSGTAGKNRVQSVGVYMGGEREEVEE-VPAGNI
130|gene|nph        IGIDPHAGEIAAGRVFSGTIEKGQDLYVSGTAGTNRVQSVGIYMGGEREEVER-VPAGNI
3388|gene|hwa       ISMDPHAGEIATGRLFSGTLEKGQELYVSGTVGTNRVQSVGIFMGGEREELDRGVPAGNI
28140|gene|hbo      IGMDPHAGEIATGRVFSGTIKKGQELYVSGTAGKNRVQSVGIFMGGEREELDRGVPAGNI
                    *.:******:*:**:****:::**:******.*.**:****::**.****::  ******

2654|gene|nrc1      AAVTGLKDAIAGSTVSNEEMTPFESIDHISEPVITKSIEAQNMDDLPKLIETLRQVSKED
152|gene|hla        ASVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAQNMDDLPKLIETLQQVAKED
12413|gene|hma      AAVTGLKDAIAGSTVSSEEMTPFESIEHISEPVITKSVEAQNMDDLPKLIETLQQVAKED
2846|gene|hhi       AAVTGLKDAIAGSTVSSEEMTPFESIEHISEPVITKSVEAQNMDDLPKLIETLQQVAKED
2874|gene|hut       AAVTGLKDAIAGSTVSSLEMTPFESIEHISEPVITKSVEAQRMDDLPKLIETLQQVSKED
130|gene|nph        AAVTGLKDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAKNMDDLPKLIETLQQVAKED
3388|gene|hwa       AAVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEATNMDDLPKLIQTLQQVAKED
28140|gene|hbo      AAVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAKNMDDLPKLIETLQQVAKED
                    *:****.*********. ********:**********:** .********:**.**:***

2654|gene|nrc1      PTISIEINEDTGEHLISGQGELHLEVQTQRIERNQGIPVTTGEPIVVYRETPTSDSQEVE
152|gene|hla        PTIQIEINEDTGEHLISGQGELHLEVITQRIRDNQGIPVITGEPIVVFREQPQEASREVE
12413|gene|hma      PTIQVEINEDTGEHLISGQGELHLEVIGQRIERNQGIPINTGEPIVVYREAPQEDSREVE
2846|gene|hhi       PTIQVEINEDTGEHLISGQGELHLEVIGQRIERNQGIPINTGEPIVVYREAPQNESREVE
2874|gene|hut       PTIEIEINEDTGEHLISGQGELHLEVVTQRIERNQGIPITTGEPIVVFREAPQESSREVE
130|gene|nph        PTIQIEINEDTGEHLISGQGELHLEVITQRIERNQGIPVNTGEPIVVFREAPQQESREVE
3388|gene|hwa       PTIRVEINEDTGEHLISGQGELHLEVITKRIQSNQGIPVQTGEPIVVYRESPQNASREVE
28140|gene|hbo      PTIRVEINEDTGEHLISGQGELHLEVITQRIQKNQGIPVVTGEPIVVYREAPQKESREVE
                    *** :*********************  :**  *****: *******:** * . *.***

2654|gene|nrc1      GVSPNRHNKFYITVEQLSDDVLEEIRLGEVSMDMPEQERREVLQEAGMDKETSQDVENII
152|gene|hla        GQSPNRHNKFYLTVEPMAQEIVDAIQLGEVSMDMPELERREALQEAGMDKDTSQNVEDIH
12413|gene|hma      GRSPNNHNRFYISIEPLGEDIVETIKMGEASMDMPELERREALQEAGMDKDDSQNIEHIH
2846|gene|hhi       GRSPNNHNRFYISIEPLGEDIVETIKMGEASMDMPELERREALQEAGMDKDDSQNIEHIH
2874|gene|hut       GISPNRHNRFYITVEPLEEDIVDAIQLGEASMDMPELERREALQEAGMDKDTSQNVEHIH
130|gene|nph        GRSPNNHNRFYITVEPLEDDIVETIKMGDVSMDMPELERREELMEQGMDKDTAQNVETIH
3388|gene|hwa       GVSPNRHNKFYITVEQLSDDIVDAIQLGEVSMDMPELERREALQEAGMDKDTSQEVEHIH
28140|gene|hbo      GVSPNRHNKFYITVEPLSEDIIEQIQLGEVSMDMPELERREALQEAGMDKDTSQNVEHIH
                    * ***.**.**:::* : ::::: *.:*:.****** **** * * ****: :*::* * 

2654|gene|nrc1      GRNIFIDDTKGIQHLNETMELVVDGLTDSLEDGPLAAEPVEGALIRLHDARLHEDAIHRG
152|gene|hla        RTNILIDDTKGIQHLNETMELVLEGLQEALDDGPLAAEPVQGSLFRLHDAKLHEDTIHRG
12413|gene|hma      GTNILLDETKGIQHLNETMELVIEGLEEALDDGPLASEPVQGSLIRLHDARLHEDAIHRG
2846|gene|hhi       GTNILLDETKGIQHLNETMELVIEGLEEALDDGPLASEPVQGSLIRLHDARLHEDAIHRG
2874|gene|hut       GTNVIIDDTKGIQHLNETMELVLEGFEEALNDGPLAAEPVQGSLIRLHDARLHEDAIHRG
130|gene|nph        NTNVFIDDTKGIQHLNETMELVVEGLEEALNDGPLAAEPVEGALIRLHDARLHEDAIHRG
3388|gene|hwa       GTNILIDDTKGIQHLNETMELVIEGLEEALDDGPLAAEPTQGALLRLHDAKLHEDTIHRG
28140|gene|hbo      GTNILIDDTKGIQHLNETMELVIEGLEEALDDGPLAAEPAQGSLLRLHDAKLHEDTIHRG
                      *:::*:**************::*: ::*:*****:**.:*:*:*****.****:****

2654|gene|nrc1      PAQVIPATRDAVHRALIDADIRLLEPIQDVRIDVPSEHMGAASGEVQGRRGRVDDMYQEG
152|gene|hla        PAQVIPAVRNAVHRSLIDGEVRLLEPIQDVRIDVPSEHMGAASGEIQGRRGRVDDMYQEG
12413|gene|hma      PAQVIPAVREAVHNSLIDASIKLLEPIQQVRIDVPNDHMGAASGEIQGRRGRVDDMYQEG
2846|gene|hhi       PAQVIPAVREAVHNALIDASIKLLEPIQQVRIDVPNDHMGAASGEIQGRRGRVDDMYQEG
2874|gene|hut       PAQVIPAVRQSLHNALIDAEIRLLEPIQDVRIDVPNEHMGAASGEVQGRRGRVDDMYQEG
130|gene|nph        PAQVIPAVREAVHNALIDAEIKLLEPIQEVRIDVPNEHMGAASGEIQGRRGRVDDMYQEG
3388|gene|hwa       PAQVIPAIRDAVHRALIDGDIKLLEPIQDVRIDVPSAHMGSASGEIQGRRGRVDDMFQEG
28140|gene|hbo      PAQVIPAVRDAVHRSLIDADIKLLEPIQNVRIDVPSEHMGSASGEIQGRRGRVDDMYQEG
                    ******* *:::*.:***..:.******:******. ***:****:**********:***

2654|gene|nrc1      DLMVVEGIAPVDEMIGFSSDIRSATEGRASWNTENAGFRVMADNLQREIIMEIRERKGMK
152|gene|hla        DLMVVEGIAPVEEMIGFSSDIRSATEGRASWNTENAGFRVLVDNLQREKIMEIRERKGMK
12413|gene|hma      DLMVVEGVAPVDEMIGFSSDIRSATEGRASWNTENAGFQVLADNLQPDKISEIRERKGMK
2846|gene|hhi       DLMVVEGVAPVDEMIGFSSDIRSATEGRASWNTENAGFQVLADNLQPDKISEIRERKGMK
2874|gene|hut       DLMVVEGIAPVEEMIGFSSDIRSATEGRASWNTENAGFRVMADNLQPETITQIRERKGMK
130|gene|nph        DLMVVEGVAPVDEMIGFSSDIRSATEGRASWNTENAGFRVMADNLQPETIDEIRERKGMK
3388|gene|hwa       DLMVIEGIAPVGEMIGFSSDIRSATEGRASWNTENAGFRVLSDTLQREKIMEIRERKGMK
28140|gene|hbo      DLMVIEGIAPVEEMIGFSSDIRSATEGRASWNTENAGFRVLSDNLQREKIMEIRERKGMK
                    ****:**:*** **************************.*: *.** : * :********

2654|gene|nrc1      TELPESITHF
152|gene|hla        LELPQSIDYF
12413|gene|hma      QELNPAIDYF
2846|gene|hhi       QELNPAIDYF
2874|gene|hut       TELPETIDYF
130|gene|nph        LELPEQIDYF
3388|gene|hwa       LELPGSVDQF
28140|gene|hbo      LELPQSIDQF
                     **   :  *