HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0597COG0064KOG2438arCOG01718Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog)Glu-tRNA amidotransferase

HOG Organism Gene ID Name Annotation
cHOG0597 nrc1 VNG0345 gatB2 Glu-tRNA amidotransferase
cHOG0597 hmu HMUK3005 Hmuk_3005 glutamyl-tRNA(Gln) amidotransferase, B subunit( EC:6.3.5.7,EC:6.3.5.6 )
cHOG0597 hma RRNAC1642 gatB aspartyl/glutamyl-tRNA amidotransferase subunit B
cHOG0597 hwa HQ1266A gatB aspartyl/glutamyl-tRNA amidotransferase subunit B
cHOG0597 hla HLAC0431 Hlac_431 glutamyl-tRNA(Gln) amidotransferase, B subunit
cHOG0597 hbo HBOR25340 Hbor_25340 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B( EC:6.3.5.6,EC:6.3.5.7 )
cHOG0597 hut HUTA2734 Huta_2734 glutamyl-tRNA(Gln) amidotransferase, B subunit
cHOG0597 hvo HVO_0684 HVO_0684 glutamyl-tRNA (Gln) amidotransferase chain B
cHOG0597 nph NP1220A gatB aspartyl/glutamyl-tRNA amidotransferase subunit B
cHOG0597 hhi 2184 gatB aspartyl/glutamyl-tRNA amidotransferase subunit B
MUSCLE (3.6) multiple sequence alignment


345|gene|nrc1       MSAQAAE-RDLTAIIGLEVHVQLETDTKIFCGCSTDTDD-ADPNTHTCPVCLGLPGALPT
431|gene|hla        MSTQAAT-EERTVVIGLEVHVQLETDTKIFCGCSTEPEEDEEPNTRTCPTCLGLPGALPV
1266|gene|hwa       MTATALAQRDFTAVIGLEVHVQLETDTKIFCGCSTRDNN-AEPNTRTCPVCLGLPGALPV
25340|gene|hbo      MTAKALSQRDLATVIGLEVHVQLETDTKIFCGCSTDAAEDEEPNTRTCPVCLGLPGALPV
1220|gene|nph       MTAQTAEEHSLTAVIGLEVHVQLETDTKIFCGCSTDADDNEEPNTRTCPVCLGLPGALPV
2734|gene|hut       MTAQAIQERDLTVVIGLEVHVQLETATKIFCGCSTDLED-ADPNTHTCPVCLGLPGSLPV
11642|gene|hma      MTAQASEARELAAVIGLEVHVQLETETKIFCGCSTDVAD-AEPNTHTCPVCLGLPGALPV
2184|gene|hhi       MTAQASEARELAAVIGLEVHVQLETETKIFCGCSTDVAD-SEPNTHTCPVCLGLPGALPV
                    *:: :    . :.:*********** *********   :  :***.***.******:**.

345|gene|nrc1       LNEGAVEAAVKLGKAIDADIPERTRFHRKNYFYPDLPKGFQITQYDAPICQDGELEVGTA
431|gene|hla        LNEGAVEAAVKIGKAIDADIPETTTFHRKNYYYPDLPKNFQLTQYDAPICQSGELEVRVD
1266|gene|hwa       LNKAAVEAAVKVGKALNADIAEKTQFHRKNYYYPDLPKNFQISQYDAPICSDGQLSISVE
25340|gene|hbo      LNEGAVEAAVKVGKALDATVAEHTRFHRKNYYYPDLPKNFQITQYDAPICADGTLEVSVE
1220|gene|nph       LNEGAVEAAVKVGKALSSDIPEETRFHRKNYYYPDLPKNFQITQYDAPICDGGELEFAVD
2734|gene|hut       LNEGAVEAAVRVGKAIDADIPEQTRFHRKNYYYPDLPKNFQISQYDAPICQDGELEFSVE
11642|gene|hma      VNEGAVEAAVKVGKAIDADIPAETTFHRKNYYYPDLPKNFQITQYDSPICQDGELEFSVE
2184|gene|hhi       VNEGAVEAAVKVGKAIDADIPEETTFHRKNYYYPDLPKNFQITQYDSPICQDGELEFSVE
                    :*:.******.:***:.: :.  * ******:******.**::***:*** .* *.. . 

345|gene|nrc1       DDRRAIGIERAHLEEDPGSLQHVGG----------SIEDADYTLVDYNRAGTPLMEIVTR
431|gene|hla        SEPRTIGITRAHLEEDPGSLQHAGG----------SIETATHTLVNYNRAGTPLMEIVTE
1266|gene|hwa       DNRREVAIRRAHLEEDPGSLTHQGG----------NIDTAEYTLVDYNRAGTPLMEIVTE
25340|gene|hbo      GERREVGIERAHLEEDPGSLQHKGG----------SIDTADYTLVNYNRAGTPLMEIVTK
1220|gene|nph       DERRTVAIERAHLEEDPGSLSHAGG----------SIDTAEHTLVDYNRAGTPLLEIVTA
2734|gene|hut       GERRTVGIERAHLEEDPGSLQHAGG----------NIDTADYTLVNYNRAGVPLMEIVTE
11642|gene|hma      SERRSVDIRRAHLEEDPGSIKHVREGSGPLESRTCSIERADYTLIDYNRAGTPLMEIVTE
2184|gene|hhi       SERRSVDIRRAHLEEDPGSIKHVREGSGPLESRTCSIERADYTLIDYNRAGTPLMEIVTE
                    .: * : * **********: *             .*: * :**::*****.**:**** 

345|gene|nrc1       PDFRAAEEVRSFLAKLTSVLEYLGVFDAERDGSLRVDANISMVDSAELAGEGGPSDDVLE
431|gene|hla        PDFRSPAETRAFLAKLEEVLEYLGVFDPTRDGSLRVDANVSLVPESEVAADGTISDDALA
1266|gene|hwa       PDFRSPAETRAFLNKLEEVLEYLGIFDPTADGSLRVDANISLIPTEDI-DNGSITTAALE
25340|gene|hbo      PDFRSPQETRAFLAKLEEVLEYLGVFDATRDGSLRIDANISMVPADEVGDDGSIADETLA
1220|gene|nph       PDFRSAAEVRAFLAKLTEVLEYLGVFDVTRDGSLRVDANLSIVDSDAVGENGSIDEATLE
2734|gene|hut       PDFRDATEVRAFLAKLEEVLEYLGIFDATRDGSLRIDANLSLVDAADVDDDGSIDQDVLE
11642|gene|hma      PDFRAPGEVRSFLEKLEEVLEYLGVFDATRDGSLRIDANLSLVDASEVGEDGDIDKSVLE
2184|gene|hhi       PDFRAPGEVRSFLEKLEEVLEYLGVFDATRDGSLRIDANLSMVDASEVGEDGDIDKSVLE
                    **** . *.*:** ** .******:**   *****:***:*::    :  :*     .* 

345|gene|nrc1       AANRTEVKNISSHRAAQKALAYETTRQRNQLERGMAVAQETRHWDEARGVTVSMRSKEEE
431|gene|hla        DVNRAEVKNISSHKGAEQALAYEVTRQENVLRRGREIEQETRHWDEARGVTVSMRSKEAE
1266|gene|hwa       SANRTEVKNISSHKGAEKALAYEVTRQRNAVERGRAIEQETRHWDESRGITVSMRSKEAE
25340|gene|hbo      AANRTEVKNISSHKGAEKALAYEVTRQKNAISRGRAIEQETRHWDESRGITVSMRSKEEE
1220|gene|nph       AANRTEVKNISSHKGAEKALAYEETRQKNAVQRGREVEQETRHWDESRGITVSMRSKEEE
2734|gene|hut       DANRTEVKNISSHKGAQKALAYEAQRQKNAVQRGREVEQETRHWDESRGITVSMRSKEEE
11642|gene|hma      DANRTEVKNISSHKGAEQALSFEASRQRKLIQSGRAVEQETRHFNETHGNTVSMRSKEEE
2184|gene|hhi       DANRTEVKNISSHKGAEQALSFEASRQRKLIQSGRAVEQETRHFNETHGNTVSMRSKEEE
                     .**:********..*::**::*  ** : :  *  : *****::*:.* ******** *

345|gene|nrc1       KDYRYFREADIPPLEVSDWKDEIPIPELPDARRERFRTEYGVGDETASKLTSRKAVADLF
431|gene|hla        KDYRYFREADLPALEVSDWKSQIPIPELPDARRERFREEYGLDRESASKLTSTKAVADFF
1266|gene|hwa       KDYRYFPEADLPPLAVADWKDQISIPELPDARRERFREEYKLDSESAAKLTSTKAVADFF
25340|gene|hbo      KDYRYFREADLPPLEVADWKEKIDIPELPDARRERFREEYGLDSESASKLTSTKEVADFY
1220|gene|nph       KDYRYFREADIPPLRVSDWKEKIDIPELPDARRERFREEYGLDAETASKLTSTKQVADFY
2734|gene|hut       KDYRYFREADLPPLEVSHWKEELSIPELPDARRERFGEEYGLNEEAASKLTTTKQVADFY
11642|gene|hma      KDYRYFREADLPPLRVSHWKDEVPIPELPDARRERFVEEYGLSEEAASKLTSTKQVADFF
2184|gene|hhi       KDYRYFREADLPPLRVSHWKDEVPIPELPDARRERFVAEYGLSEEAASKLTSTKQVADFF
                    ****** ***:*.* *: **.:: ************  ** :. *:*:***: * ***::

345|gene|nrc1       EELADEYDAALAATWVADNVLGELNYRDLSLDDVADRDDEFERLVELVAEDEITAKNAEE
431|gene|hla        EDVAEQFDPELAATWVADNLLGELNYREMSITDVEDRLDEFKRLIELVAADELTVKNAEE
1266|gene|hwa       ESVADQFDPALAATWVADNLLGELNYRDMTVGDIDDRFDEFTQLIELVDDEDITTKNAEE
25340|gene|hbo      EDVADKFDPSLAATWVADNLLGELNYRDMQITEITHRLDEFTRLVELVDAGDITTKNAEE
1220|gene|nph       ERVADTFAPELAATWVADNLLGELNYRDMEITDIEGRLDEFAHLIELVDEDEITVKNAEE
2734|gene|hut       EDLASEFDPDLVATWVADELLGELNYRDMEITDVTDRLDEIERLVELVASEEITAKNARE
11642|gene|hma      EDVAERFDANLAATWVADNLLGELNYRDMAITDIDDRFDEVTQLVALVAEDEITAKNAHE
2184|gene|hhi       EDVAERFDADLAATWVADNLLGELNYRDMAITDIDDRFDEVTRLVELVAEDDITAKNAHE
                    * :*. : . *.******::*******:: : ::  * **. .*: **   ::*.*** *

345|gene|nrc1       VVLRTMLDEDRAPDEIVDAEGLGKTSGDAVADAVAEAIAENPDAVADYHDGEGDALNFLV
431|gene|hla        IVLREMLDAGEDPETVIEREGLGVADSGEVAAAVTAAIDDNPDAVSDYHDGDEGAINFLV
1266|gene|hwa       VVLRRMLDDELTPEAVIESEGLGRADEDEVVTAVTGAIDESPEAVEDYHAGEGGAINFLV
25340|gene|hbo      VVLRRMLDDGESPDDIVEAEGLGAADDDEVVTAVTEAIEENPDAVEDYHAGEGGAINFLV
1220|gene|nph       VVLRRMLDDGQPPGDIVEAEDLGKTDDDAVAAAVTAAIEENPDAVEDYHAGEDGALNFLV
2734|gene|hut       TVLRGMLDDGDDPDTIVDREGLGKTQRDELQGAVEEAIEENPDAVSDYHDGGGGAINFLV
11642|gene|hma      TVLREMLDTGDDPDTVVDREGLGKTSGDEVQQAVVEAIDENPDAVEDYHSGEGGAINFLV
2184|gene|hhi       TVLREMLDTGDGPDAVVDREGLGKTSGDEVQQAVVDAIDENPDAVEDYHSGEDGAINFLV
                     *** ***    *  ::: *.** :. . :  **  ** :.*:** *** *  .*:****

345|gene|nrc1       GQVMAKTGGSADPGQVNELLRDELAQA-
431|gene|hla        GQVMQATGGSADPGEVNGLLREELDG--
1266|gene|hwa       GQVMQKTGGSADPSKVNTLLREQLEDKK
25340|gene|hbo      GQVMQKTGGSADPGDVNQMLRDELDE--
1220|gene|nph       GQVMQETGGSADPGTVNELLRAELDG--
2734|gene|hut       GQVMQKTGGSADPGDVNQLLRAELED--
11642|gene|hma      GQVMEKTGGSADPGDVNGLLREELES--
2184|gene|hhi       GQVMQKTGGSADPGDVNGLLREELES--
                    ****  *******. ** :** :*