HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0596arCOG04665hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0596 nrc1 VNG0233 vng233 no entry
tucHOG0596 hmu HMUK0007 Hmuk_0007 conserved hypothetical protein
tucHOG0596 hma RRNAC1681 hypothetical protein
tucHOG0596 hwa HQ1287A hypothetical protein
tucHOG0596 hla HLAC0568 Hlac_568 hypothetical protein
tucHOG0596 hbo HBOR25590 Hbor_25590 hypothetical protein
tucHOG0596 hut HUTA2677 Huta_2677 conserved hypothetical protein
tucHOG0596 hvo HVO_0650 HVO_0650 conserved hypothetical protein
tucHOG0596 nph NP0614A hypothetical protein
tucHOG0596 hhi 2217 HAH_2217 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


614|hp|nph        ----------------MTADDSDEPTADEIVEVASDAAEGLILSRYKQSEVTDMDVTVRF
1287|hp|hwa       -----------MHEHETIVMSPSTPSDEAVVQTAADAAEGVIFAEYRQSTVTDVDITVSF
233|hp|nrc1       -----------------------MPNDEEVVETAAEAAEGLVLDRLRTSDVDDLDITVTF
2677|chp|hut      -----------MSDDATASTDAETPADETVVETAAATAEDVVFSRLDRSAIDDLDVTVTF
11681|hp|hma      -----------------------MPTDDEVVETASAAAEDVVFSRYDVGAVEDLDVTVTF
2217|hp|hhi       -----------------------MPTDDEVVETASTAAEDVVFSRYDVSAVEDLDVTVTF
568|hp|hla        MSDESSDGPTDGPRDVADEAADEGPTDDEVVRTAAKAAEGVVFAHYDQSAVTDLDVTVTF
25590|hp|hbo      -----------------------MPTDETVVETAAEAAEGVIFARYKQSDVKDFDVTVTF
                                          *  : :* .*: :**.:::     . : *.*:** *

614|hp|nph        EDGTLDVDIYLNAPDDP-DPGA--VAQEAVEAAESAVDELFE-----------
1287|hp|hwa       ESGVLEVDVYLNIPDDVSPPAD-DVADEAARTAQAAVDELFDETQG-------
233|hp|nrc1       EDGVLDVDIYVRAPDADADVEQ--VADDGALAAQAAVDDLFADE---------
2677|chp|hut      EDKVLEIDVYLNAPDARADPET--VADDAALAARSAVDDLFDA----------
11681|hp|hma      EDGVLDVDVYVNAPDSRQDEAQ--VADDAALAARAAVDDLFEE----------
2217|hp|hhi       EDGVLDVDVYVNAPDSRQDEAQ--VADDAALAARAAVDDLFEE----------
568|hp|hla        EDGVLDVDVYLNAPDDP-DPDA--VAREAAETAGEAVDELFEA----------
25590|hp|hbo      EDGILDVDVYINAPDDA-DADADDVADEAARTAQDAVDELFAESDADSDANAA
                  *.  *::*:*:. **         ** :.. :*  ***:**