HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0595COG0034KOG0572arCOG00093Glutamine phosphoribosylpyrophosphate amidotransferaseamidophosphoribosyl-pyrophosphate amidotransferase

HOG Organism Gene ID Name Annotation
cHOG0595 nrc1 VNG1493 purF amidophosphoribosyl-pyrophosphate amidotransferase
cHOG0595 hmu HMUK2095 Hmuk_2095 amidophosphoribosyltransferase( EC:2.4.2.14 )
cHOG0595 hma RRNAC0797 purF amidophosphoribosyl transferase
cHOG0595 hwa HQ2893A purF amidophosphoribosyltransferase
cHOG0595 hla HLAC1477 Hlac_1477 amidophosphoribosyltransferase
cHOG0595 hbo HBOR11880 Hbor_11880 amidophosphoribosyltransferase( EC:2.4.2.14 )
cHOG0595 hut HUTA0672 Huta_0672 amidophosphoribosyltransferase
cHOG0595 hvo HVO_2721 HVO_2721 purF amidophosphoribosyltransferase
cHOG0595 nph NP4312A purF amidophosphoribosyltransferase
cHOG0595 hhi 1442 purF amidophosphoribosyltransferase
MUSCLE (3.6) multiple sequence alignment


1493|gene|nrc1      -MSGGPADGPMS------------------------------------------------
1477|gene|hla       MQAGGDHTA---------------------------------------------------
2893|gene|hwa       MSDGRDV-TPTPGRAIESGTESKSETKPDANPDAETGGGGDAGADAGAHKTKELDSEVLS
11880|gene|hbo      MSDGRDAQTPTPGR------------------------------DAGRQQPTA-------
4312|gene|nph       MPDGRHS-----------------------------------------------------
672|gene|hut        ------------------------------------------------------------
10797|gene|hma      ------------------------------------------------------------
1442|gene|hhi       ------------------------------------------------------------
                                                                                

1493|gene|nrc1      ------------------------------------------------------------
1477|gene|hla       ------------------------------------------------------------
2893|gene|hwa       QLSADRDDISTEDKIETKTKTKIKAGNESDHNAGNNHSNAIDQTTDLKSASSLNSGTSVP
11880|gene|hbo      ------DDL---------------------------------------------------
4312|gene|nph       ------------------------------------------------------------
672|gene|hut        ------------------------------------------------------------
10797|gene|hma      ------------------------------------------------------------
1442|gene|hhi       ------------------------------------------------------------
                                                                                

1493|gene|nrc1      -----------------------DHPTEKCGVVGASLSARDAALPTYYALYALQHRGQES
1477|gene|hla       -----------------------DEPREKCGVVGVSLADREAARPLYYALYALQHRGQES
2893|gene|hwa       ISQPSKISSSEDKQQTQRQTNSGSGPTEKCGVVGVALTGRRAARPLYYSLYALQHRGQES
11880|gene|hbo      -----------------------SGPTEKCGVVGVALADRAAARPLYYSLYALQHRGQES
4312|gene|nph       -----------------------DEPTEKCGVVGVSLDGRDAARPLYYALYALQHRGQES
672|gene|hut        -------------------------MDEKCGVVGISLQDREAARPLYYSLYALQHRGQES
10797|gene|hma      -------------------------MHEKCGVVGISLEDRDAARPLYYSLYALQHRGQES
1442|gene|hhi       -------------------------MHEKCGVVGISLEDRDAARPLYYSLYALQHRGQES
                                               ******* :*  * ** * **:***********

1493|gene|nrc1      AGIVAHDGFQQHQHVGMGLVGDAFDEADIDALHGSAAIGHVRYPTAGSVDKSCAQPFSVS
1477|gene|hla       AGIVTHDGFQQHSHVERGLVGDAFDEGDLESLSGGTGIGHVRYPTAGSLDKSCAQPFSVS
2893|gene|hwa       AGIVTHDGFQQHSHVEMGLVGDAFDESDLNTLAGGTGIGHVRYPTSGGVNACCAQPFSVS
11880|gene|hbo      AGIVTHDGFQQHSHVETGLVGDVFGESDLDSLTGTTGIGHVRYPTSGGLDSCCAQPFSVS
4312|gene|nph       AGIVTHDGFQQHSHVEMGLVGDAFEEGDLDSLNGPTGIGHVRYPTAGSVNSSCAQPFSVS
672|gene|hut        AGIVTHDGFQQHSHIGMGLVGDVFDSGDIDDLTGAVGIGHVRYPTAGSVDSSCAQPFTVS
10797|gene|hma      AGIVTHDGFQQYSHVEMGLVGDAFDPGDLEALNGSNGIGHVRYPTAGSVNACCAQPFSVS
1442|gene|hhi       AGIVTHDGFQQYSHVEMGLVGDAFDPGDLESLNGANGIGHVRYPTAGSVNACCAQPFSVS
                    ****:******:.*:  *****.*  .*:: * *  .********:*.:: .*****:**

1493|gene|nrc1      FKGGALGLSHNGNLVNADELRADLAASGHAFTSDGDTEVIAHDLARNLLDADLVDAVERT
1477|gene|hla       FKSGSLGLSHNGNLVNADEVREELAAAGHAFTSDGDTEVIAHDLARNLLEEDLVRAVKHT
2893|gene|hwa       FKSGSLGLSHNGNLVNADEIRDELESLGHAFTSDGDTEVIAHELARNLLEADLVRAVKQT
11880|gene|hbo      FKSGSLGLAHNGNLVNADEIRDELEDLGHAFTSDGDTEVIAHDLARNLLEEDLVRAVKHT
4312|gene|nph       FKSGSLGLSHNGNLVNADELRQDLAASGHAFTSDGDTEVIAHDLARNLLEEDLIRAVKRT
672|gene|hut        FKSGSLALSHNGNLVNADDVRDELANLGHAFTSDGDTEVIAHDLARNLLEADLVRAVKRT
10797|gene|hma      FKSGSLGLSHNGNLVNADEIGDELADLGHAFTSDGDTEVIAHDLARNLLEEDLVRAVKRT
1442|gene|hhi       FKSGSLGLSHNGNLVNADEIGDELADLGHAFTSDGDTEVIAHDLARNLLEEDLVRAVKRT
                    **.*:*.*:*********::  :*   ***************:******: **: **:.*

1493|gene|nrc1      MERIHGSYSLTIMHDDTVLGVRDPRGNRPLVLGTVEDGYVIASESAAIDTIGGDVVRDVR
1477|gene|hla       MNRIHGSYSLAIAHDDTVLGVRDPLGNRPLCLGKIDGGYVLASESAAIDTLDGELIRDVR
2893|gene|hwa       MERIHGSYALTIMHDETVLAVRDPEGNRPLCIGEVEDGYVVASESAAIDTLDGELVRDVR
11880|gene|hbo      MGRIHGSYSLTIMHDETVLAVRDPQGNRPLCIGKLDDGYVVASESAAIDTLDGDLVRDVR
4312|gene|nph       MNRIHGSYSLTITHDDTVLGVRDPQGNRPLCIGELDDGYILASESAAIDVLDGEFVRDVN
672|gene|hut        MKRIHGSYSLTITHDDTVLGVRDPEGNRPLCIGELEDGYVLASESAAIDTLDGEVIRDVR
10797|gene|hma      MNRIHGSYSLTIMHDETVLGVRDPQGNRPLCIGELKDGYVLASESAAIDTLDGELIRDVK
1442|gene|hhi       MNRIHGSYSLTIMHDETVLGVRDPQGNRPLCIGELEDGYVLASESAAIDTLDGELIRDVK
                    * ******:*:* **:***.**** ***** :* :..**::********.:.*:.:***.

1493|gene|nrc1      PGEAIVLDDDGTGFSAHQLVDRDTTAHCFFEYVYFARPDSVIDDELVYEVRRNLGRQLWH
1477|gene|hla       PGELVVLEPDGTGYDTYQLVERESTAHCFFEHVYFARPDSVIDENLVYEVRRALGRKLWE
2893|gene|hwa       PGELVVLDADGSGFESYQLTDRQNTAHCFFEHVYFARPDSVINETLVYEARRNLGRKLWA
11880|gene|hbo      PGELVVLESDGSGFDSYQLVEQEHTAHCFFEHVYFARPDSVIDDTLVYEARRDLGRKLWE
4312|gene|nph       PGELVVLDDDGGGYDSYQLVDAENSAHCFFEHVYFARPDSRIDSKLVYDVRRELGRKLWE
672|gene|hut        PGELVVLQPDGEGYDTYQLVEHDRTAHCFFEHVYFARPDSDIDGQLVYDTRRELGRKLYD
10797|gene|hma      PGELVVLHADGTGYDTYQLVEPENTANCFFEHVYFARPDSTIDENLVYEVRRELGRKLWE
1442|gene|hhi       PGELVVLHADGTGYDTYQLVEPENTAHCFFEHVYFARPDSTIDENLVYEVRRELGRKLWE
                    *** :**  ** *:.::**.: : :*:****:******** *:  ***:.** ***:*: 

1493|gene|nrc1      ETGVESDVVVPVPDSGRAFASGYADAATEDGSD-------------VEFAEGLMKNRYVG
1477|gene|hla       ESGVESDVVMPVPDSGRAFASGYADAAGETTADGEPRED---GDDGIAFAEGLMKNRYVG
2893|gene|hwa       EQGVETDVVMPVPDSGRAFASGYADAANETTADGDIRETTSTNDDAIEFAEGLMKNRYVG
11880|gene|hbo      ESGVESDVVMPVPDSGRAFATGYAEAANETTADGDPRES----DDSVEFAEGLMKNRYVG
4312|gene|nph       EAGVESDVVVPVPDSGRAFASGYAEAAQEDGTN-------------VEFAEGLMKNRYVG
672|gene|hut        ESGIDTDVVLPVPDSGRAFASGYAAAAE----D-------------VEFAEGLMKNRYVG
10797|gene|hma      ESGVESDVVLPVPDSGRAFASGYAEAAQDDGSD-------------IEFAEGLMKNRYVG
1442|gene|hhi       ESGVESDVVLPVPDSGRAFASGYAEAAQDDGSD-------------IEFAEGLMKNRYVG
                    * *:::***:**********:*** **     :             : ************

1493|gene|nrc1      RTFIMPTQEARERAVRLKLNPIKSTVEGQSVTIIDDSIVRGTTSSQLVDLVRDAGATEVH
1477|gene|hla       RTFIMPTQDERERAVRLKLNPIRSTVEGKSVTIIDDSIVRGTTSTQLVELVREAGAEEVH
2893|gene|hwa       RTFIMPTQDERERAVRLKLNPIKSTVEGRSVTIIDDSIVRGTTSRQLVQLLRDAGASEVH
11880|gene|hbo      RTFIMPTQDERERAVRLKLNPIKSTIEGRSVTIIDDSIVRGTTSRQLVQLVRDAGAEEVH
4312|gene|nph       RTFIMPTQDARERAVRLKLNPIKDVIEGKTVTVIDDSIVRGTTSTQLVELLKDVGAESVH
672|gene|hut        RTFIMPTQDERERAVRLKLNPIRNTIEGKSVTLIDDSIVRGTTSTQLIDLLRDAGAEEIH
10797|gene|hma      RTFIMPTQDERERAVRLKLNPIKSTIEGKSVTIIDDSIVRGTTSTQLIKLLKDAGAEEVN
1442|gene|hhi       RTFIMPTQDERERAVRLKLNPIKSTIEGKSVTIIDDSIVRGTTSTQLIQLLKDAGAEEVH
                    ********: ************...:**.:**:*********** **:.*:.:.** .::

1493|gene|nrc1      VRIGAPQIQAPCYFGIDMATREELIAADRTADEIAAEIGADSLSYLPLSAVTAAIGKSEA
1477|gene|hla       LRIGAPAIIAPCYFGIDMATREELIAADASTEEIREKVGADSLSYLSVDAVADALGESRA
2893|gene|hwa       VRIGAPQIIAPCYMGIDMASRDELIAADKSTEEIRAEIDADSLGYLSVDAVADVLGEHRS
11880|gene|hbo      VRIGAPPIIAPCYMGIDMATREELIASDKTTEEIRDDIGADSLSYLSIDAIAAALGESRA
4312|gene|nph       MRIGAPAIVAPCYMGIDMASRDELIAAGRDVEEIREEIAADSLSYLSVDAVAEALGESED
672|gene|hut        LRIGSPPIVAPCYMGIDMASRDELIAGDRSVEEIRETIGADSLSYLSIDAISETLGTDRD
10797|gene|hma      VRIGAPPIVAPCYMGIDMASRDELIAGNQSVEEIRDEIEADSLSYLSIDAIAETLDKSRT
1442|gene|hhi       VRIGAPPIVAPCYMGIDMASRDELIAGNQSVDEIRDEIEADSLSYLSIDAIAETLDKSRA
                    :***:* * ****:*****:*:****..  .:**   : ****.**.:.*:: .:.    

1493|gene|nrc1      DMCAGCVTGAYPYDVDGEATDRDAERPTVT-------------------------PSS--
1477|gene|hla       DLCLGCVTGEYPFDVEGEETDRDIEGVASG------------------------VSPA--
2893|gene|hwa       DLCLGCVTGSYPYDIDNEDSDRDVTRPVIAGPDTGADATNQKNESKQEAASDGEPARA--
11880|gene|hbo      DLCLGCVTSEYPYDIDGEPTDRSVERPSIS----------------------DETLPA--
4312|gene|nph       DLCLGCVTGEYPYDIEGEPTDRDIARPEVG----------------------GDQPEAGV
672|gene|hut        DLCLGCVTGEYPYDIDGEATDREIARPVID----------------------G-ASVA--
10797|gene|hma      DLCLGCVTGEYPYDIEGEATDRDVVRPDIG----------------------TQSSPA--
1442|gene|hhi       DLCLGCVTGEYPYDIDGEATDRDVTRPDIG----------------------TQSRPA--
                    *:* ****. **:*::.* :**.                                  :  

1493|gene|nrc1      ---DD
1477|gene|hla       ---DD
2893|gene|hwa       ---DD
11880|gene|hbo      ---DD
4312|gene|nph       AGSDD
672|gene|hut        ---ED
10797|gene|hma      ---DD
1442|gene|hhi       ---DD
                       :*