HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0594COG1648arCOG01044Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0594 nrc1 VNG1775 vng1775 no entry
cHOG0594 hmu HMUK1613 Hmuk_1613 siroheme synthase( EC:4.99.1.4 )
cHOG0594 hma RRNAC1709 hemX uroporphyrin-III C-methyltransferase
cHOG0594 hwa HQ3335A cysG siroheme synthase
cHOG0594 hla HLAC2131 Hlac_2131 siroheme synthase
cHOG0594 hbo HBOR07270 Hbor_07270 siroheme synthase, N-terminal domain( EC:4.99.1.4 )
cHOG0594 hut HUTA1755 Huta_1755 siroheme synthase
cHOG0594 hvo HVO_2312 HVO_2312 uroporphyrin-III C-methyltransferase
cHOG0594 nph NP4500A cysG1 siroheme synthase (precorrin-2 oxidase; ferrochelatase )
cHOG0594 hhi 2244 hemX uroporphyrin-III C-methyltransferase
MUSCLE (3.6) multiple sequence alignment


1755|gene|hut       MIPLLHDFSDCRVLVFGGGPVGARKARRFDHEAE-VVVVAPEFADA-------DFGEATL
1775|chp|nrc1       MIPLLHDFHGASVLVVGGGAVGARKARRFAAEADRVVVVSPAFGDR-------EFGDADR
11709|gene|hma      MIPLMHDFEGETVLVVGGGSVGARKARTFATEAS-VVVLSPEFGDR-------TFADAEK
2244|gene|hhi       ----MHDFEGETVLVVGGGPVGARKARTFATEAS-VVVLSPEFADR-------AFADAEK
3335|gene|hwa       MIPLYHDFTEEKVMIFGGGPVGARKARRFSSEAH-VIVISPTFSKD-------SFGTASL
4500|gene|nph       MIPLYHDFTGQTVLVFGGGSVGARKARRFAREAD-VVVVSPAFPEA-------DYGGASL
2131|gene|hla       MIPLYHDFTGETVLVFGGGTVGSRKASRFADEAR-VVVVSPGFDDRLVDLAEEDRESVEL
7270|gene|hbo       MIPLYHDFTDESVLVFGGGPVGARKARRFAAEAN-VIVVSPRFEED-------DYGDAEC
                         ***    *::.***.**:***  *  **  *:*::* * .            .  

1755|gene|hut       ERASPDPTEVSEWLDRIEPALVVAATDDAAVNAAVERAAGDRGVLVNRAD-----HSGER
1775|chp|nrc1       VRAAPDPDGAADWVARVDPALVVAATSDSDVNAAFAAAARDAGALVNRAD-----VAGDR
11709|gene|hma      VRAAPTPEDATDWVERTDPALVVAATDDSDLNGAFSTAAAEHGALVNRTD-----DHGDQ
2244|gene|hhi       VRAAPDPEDAEEWVERTDPALVVAATDDSALNDAFTAVAEEHGALVNRAD-----DHGDQ
3335|gene|hwa       VRAAPSPSDVHEWVTRADPTLIIAATGNDELNNSIADIAHDNELLLNRADRSKANSKENR
4500|gene|nph       VRAAPEPEAVDDWFDRTEPALAVAATDDAAVNEAVAEAATARGRLVNRTD-----RSGGR
2131|gene|hla       VRATPDAEAIHGWIDRVDPALVVAATDDAAVNAAAEAAALDTGALVNRTDVSAGDRSGGR
7270|gene|hbo       VRAEPTPDDVSDWVSRVEPALVVAATPDGGVNDAAERAAQETGALVNRADESAAAGDGDR
                     ** * .     *. * :*:* :*** :  :* :    *     *:**:*         .

1755|gene|hut       SP-GA---VVLPAIARDDPVVVGISTQGGAPAVSGVLREEIEREIDGAGALAGFVGDLRE
1775|chp|nrc1       DHSGD---VVVPATAGDPPVTIAVSTGGRSPALSKHLRERIDEEFAGAGGMAVLTGRIRD
11709|gene|hma      SF-GN---IVVPATVRDDPVTLAIATGGRAPALSKHLRERFEDEFGNAGLMADLVGDLRE
2244|gene|hhi       SF-GN---VVVPATVRDDPVTLAIATGGRAPALSKHLRERFEDEFGNAGLMAELVGDLRE
3335|gene|hwa       AL-STAYEVMTPATVEDGPIQVAVSTGGRSPALAKYLREQIETDIESAGAMATLTADLRA
4500|gene|nph       DP-GS---VVVPATVRDGDVTVAISTGGQSPALARELRKRIESEIEGAGELATTTASLRE
2131|gene|hla       DV-RS---VVVPATIEDDPVRVALSTGGASPALAKALRERIEAEIDGAGAMAELSGTLRA
7270|gene|hbo       AA-RS---AVVPATIEDGDVRVAISTGGASPALAKYLRERIESEIDGAGAMAELTGQLRQ
                             : **   *  : :.::* * :**::  **: :: :: .** :*   . :* 

1755|gene|hut       RFADLGVDGPHRRDALRAIARSDRIRALVADGQTDQAREVAETVLTEVRNSSE---
1775|chp|nrc1       DLRSTGLSPAERRDAVRAVVRSTPVWKALRTGDA-NPRVRAEAAVARAVGDVDWST
11709|gene|hma      DLRDRGVPPAKRRDAVRFVVRSREVWKALDSGRS-KGEQVARDVIGELPGDQT---
2244|gene|hhi       DLRDRGVPPAERRDAVRLVVRSREVWKALDSGRY-KGEQVARDVIGELPGDQT---
3335|gene|hwa       ELRGRECSPSERRDAIRSVVRDPDVWKGLRTGEN-NARQEATRVIRNTMGGER---
4500|gene|nph       QLKDRDISPAARRQAVRDVVQSPQVWKDLGTGVS-KHRQTVDAVVESALGDTQ---
2131|gene|hla       ELKDRDVPPEKRREAIRRVVRSEGVWKALQKGDS-YGRQEADSVIEEVLNR-----
7270|gene|hbo       ELRETDYTPDERRAAVRAVVQSPKVWKALRTGES-KARQEADRVIRNTVGGER---
                     :         ** *:* :...  :.  :  *        .  .:    .