HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0593COG0563KOG3079 KOG3078arCOG01046Adenylate kinase and related kinasesadenylate kinase

HOG Organism Gene ID Name Annotation
cHOG0593 nrc1 VNG1724 adk adenylate kinase
cHOG0593 hmu HMUK1736 Hmuk_1736 adenylate kinase( EC:2.7.4.3 )
cHOG0593 hma RRNAC3346 adk adenylate kinase
cHOG0593 hwa HQ2767A adk adenylate kinase
cHOG0593 hla HLAC1912 Hlac_1912 adenylate kinase
cHOG0593 hbo HBOR09180 Hbor_09180 Adenylate kinase( EC:2.7.4.3 )
cHOG0593 hut HUTA2319 Huta_2319 adenylate kinase
cHOG0593 hvo HVO_2496 HVO_2496 adk Adenylate kinase
cHOG0593 nph NP4910A adk adenylate kinase
cHOG0593 hhi 586 adk2 adenylate kinase
MUSCLE (3.6) multiple sequence alignment


4910|gene|nph       ---------MSQPKILLLGAPGAGKGTQSSNIVDEYGVDHITTGDALRANKDMET-----
1724|gene|nrc1      ---------MSHPNVLLLGAPGAGKGTQSRRLVDEFGVEHVTTGDALRANKTKDITHLDV
2319|gene|hut       ---------MRNPKILLLGPPGAGKGTQSSNLVSEFGIEHVTTGDALRSNKGMDISDLGL
13346|gene|hma      ---------MSNPRILIVGPPGAGKGTQSANLAEAYGVEHITTGDALRANKDMDISDMDT
586|gene|hhi        ---------MSNPRILILGPPGAGKGTQSANLAEEYGVEHITTGDALRANKDMDISDMDT
2767|gene|hwa       MLYGERQISSMEKHILLLGPPGAGKGTQSKRLAEEFGLEHVTTGDALRGNKQMDISEMDT
1912|gene|hla       ----------MSHRILLLGAPGAGKGTQSAKLADEYDVEHVTTGDALRANKDMET-----
9180|gene|hbo       ----------MGKHILLLGAPGAGKGTQSKRLASEFDLEHVTTGDALRANKDMDISDMDF
                                 .:*::*.********* .:.. :.::*:*******.**  :      

4910|gene|nph       EHGTPREFMEAGELVPDPVVNEIVQAAIDEADGFVLDGYPRNLSQAEYLSDITDVDVVAL
1724|gene|nrc1      EYDTPGAYMDAGELVPDAVVNEIVKTALDDADGYVLDGYPRNESQTEYLDSITDLDVVLY
2319|gene|hut       EYDTPGEYMDRGELVPDEVVTAIVEEALTSADGFVLDGYPRNLEQAEELETMTDLDVIAS
13346|gene|hma      EYDTPREYMEAGDLVPDAVVNAIVDEALSQADGFVLDGYPRNLEQAEELEGMTALDVILS
586|gene|hhi        EYDTPREYMEAGDLVPDAVVNAIVDEALSQADGFVLDGYPRNLEQAEELEGMTDLDVILS
2767|gene|hwa       EYDTPGAYMDAGELVPDAVVNKIVEEALSSADGYVLDGYPRNIEQAEVLSSITELDVAIL
1912|gene|hla       EYGTPRSFMEAGELVPDPVVNEIVKAALADADGFVLDGYPRNLDQAEYLSEITDLDAVIF
9180|gene|hbo       EYDTPREYMESGDLVPDDVVNEIVKTALQEADGYVLDGYPRNIEQAEYLTEITDLDAVLY
                    *:.**  :*: *:**** **. **. *: .***:******** .*:* *  :* :*.   

4910|gene|nph       LDVGRDELVDRLTGRRMDPETGDIYHTEFNMPDDEEVRE----RLVQRDDDTEETVNERL
1724|gene|nrc1      LDVDEDELVGRLTGRRVCEDCGATFHVSFNQPETEGVCDACGGSLYQREDDTEETARERI
2319|gene|hut       LSVGEEELVDRLTGRRVCSDCGENYHVEFDQPDADGVCDECGGELIQREDDQEEAVRNRL
13346|gene|hma      LDVSREELVDRLTGRRVCDDCGTNYHVEFNQPEEDGVCDECGGDLIQRDDDNEESVRNRL
586|gene|hhi        LDVSREELVDRLTGRRVCDDCGTNYHVEFNQPEEDGVCDDCGGDLIQRDDDNEESVRNRL
2767|gene|hwa       LSVSEEELVDRLTGRRVCPECGASYHIEFEPPAETGVCDECGATLTQRDDDTEETVRDRL
1912|gene|hla       LDVDEEVLVDRLTGRRVCDDCGANFHVDFQPPEEAGVCDECGGELIQRDDDTEETARERL
9180|gene|hbo       LDVSEEELVERLTGRRVCDDCGANYHVEFAPPEEDGVCDDCGGELIQREDDTEETVRERL
                    *.*. : ** ******:  : *  :* .*  *    * :     * **:** **:..:*:

4910|gene|nph       DVFDENTQPVIDYYEDEGELVRIDGEASPDEVWDDLQAAIDDAL--
1724|gene|nrc1      TVYEENTAPVVEYFREQGVLAEVDGERTPDEVWTDVAAAVDERTA-
2319|gene|hut       DVFAENTEPVIEYYSDREAFVEIDGEQSLDAVWADLKDAVEDELQS
13346|gene|hma      DVFDDNTAPVIDHYGDHDGFVAIDGEQTPDEVWSEIQDAVDAHTA-
586|gene|hhi        DVFDDNTAPVIDHYGDHDGFVAVDGEQTPDEVWNDIQDAVDAQTA-
2767|gene|hwa       RVYEENTEPVVEHYRDRDKLVTVNGETTPGDVFDSIVDVINS----
1912|gene|hla       EVFYENTEPVIDHFRDEGDLVEVDGEATPDEVFERIRDVLDE----
9180|gene|hbo       TVYHKNTEPVVNHYRDEGVLVEIDGEQTPDGVFDDVAEVVEDA---
                     *: .** **:::: :   :. ::** : . *:  :  .::