HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0592COG0561KOG3189arCOG01213Predicted hydrolases of the HAD superfamilyhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0592 nrc1 VNG0718 vng718 no entry
cHOG0592 hmu HMUK1809 Hmuk_1809 SPP-like hydrolase
cHOG0592 hma RRNAC1620 haloacid dehalogenase-like hydrolase
cHOG0592 hwa HQ2676A hypothetical protein
cHOG0592 hla HLAC1119 Hlac_1119 SPP-like hydrolase
cHOG0592 hbo HBOR16930 Hbor_16930 phosphoglycolate phosphatase
cHOG0592 hut HUTA1156 Huta_1156 SPP-like hydrolase
cHOG0592 hvo HVO_1536 HVO_1536 SPP-like hydrolase Archaeal
cHOG0592 nph NP1738A hypothetical protein
cHOG0592 hhi 2162 HAH_2162 putative haloacid dehalogenase hydrolase
MUSCLE (3.6) multiple sequence alignment


1119|gene|hla       -------MVPPLALDIDGTLTTASGRLDARVFELLPDWDAPVVLATGKAFPYPVALAHFL
2676|hp|hwa         MYTDADATVPPLVLDIDGTLTDAPGRLDPRVPVYLQSWDAPIVLATGKSFPYPVALCHFL
16930|gene|hbo      ----MASDVPPLVLDIDGTLTDEPGRLDPRAFDVLPSWDAPVVLATGKSFPYPVSLCHYL
718|chp|nrc1        ----MDTADPPLAVDIDGTLSRADRSIDGRVLDVLRGWDGPVVVATGKALPYAVALCQFA
1738|hp|nph         -------MVAPLAVDIDGTLTRPDKSIDPRVFDAIRAWDDHVVIATGKSFPYPVGLCEFL
1156|gene|hut       --MAESGSAPPLVTDVDGTLTDDELRLDPRMGTALREWDGPVVLATGKVLPFPIALANYL
11620|gene|hma      ----MDSDTPPLIVDIDGTLTDESRALDPHVIPVLREWPARVVIATGKAMPFPIALCEFL
2162|gene|hhi       ----MDNDTPPLIVDIDGTLTDESRAIDPRVMPVLREWPARVVIATGKAMPFPIALCEFL
                             .**  *:****:     :* .    :  *   :*:**** :*:.:.*. : 

1119|gene|hla       GRAETVIAENGGVVHVD--GETAILGDAEAPRAVVEAFRERGGDPGWGARDTVNRWRETE
2676|hp|hwa         GIEQTVIAENGGVILAD--ETVSYQGDSERAQAAASVFEERGGELGWGGFDDVNKWRETE
16930|gene|hbo      GLERNVVAENGGVVLAN--GEVTYTGDKERAQAVADEFVARGGDLGWGSFDDTNYWRETE
718|chp|nrc1        GIDERVIAENGGVAYVG--DELLHFGDSRAVEQVAAAFEDAGHDIGWGDADLTNRWRETE
1738|hp|nph         GMPLNVIAENGGAVYVEPAGEVVYNGDPEGAAAVAEEYVAAGYDLGWGAVDMVNRWRETE
1156|gene|hut       GIERTVIAENGGVTFVDATDELGVHGDREAAQAVADAYVDAGYDLGWGPADLPNRWRETE
11620|gene|hma      GLDRTVVAENGGVVFVEATDELRLEGDHEAALAVGESYRDLGHDLGFGQIDLANRWRETE
2162|gene|hhi       GIERTVVAENGGVVFVEATDELRLEGDHEAALAVGEAYRDLGHDLGFGQVDLANRWRETE
                    *    *:*****.  .         **      .   :   * : *:*  *  * *****

1119|gene|hla       VALSLDADEALLREVAAAAGGDVEVVDTGYAYHVKSTGVSKGRGLERVGDALGIGPDEFV
2676|hp|hwa         IAVDLSADEELLREVAAEFD--LTVIDTGYAYHLKTPGVEKGDGLKAVCETLELDPDSFV
16930|gene|hbo      IAVSLAADEKLLREVATEYE--MDVIDTGYAYHVKTPGVEKGIGFKRLCETLSMDPDEFV
718|chp|nrc1        LAVSREQPLDVLSALAADHG--LHVVDTGFAYHVKPESMSKGNALPAVAARLGVTAGDFV
1738|hp|nph         LAVDRDQPLEPLVAIADDHG--MDVVDTGYAYHVKDAGVDKATGLETVAELLGVVPSSFI
1156|gene|hut       VIAARDQPLEPLRDLAAEHG--LEVVDTQYAYHVKSPSMTKGKGLETVADALGYEPTEFV
11620|gene|hma      LVVSLDQPLEPLEELAAARG--LVVLDTGFAYHVTDPVVDKGTGLEAVCSELDLDPAEFL
2162|gene|hhi       LVVSLDQPLEPLEDLAAARG--LVVLDTGFAYHVTDPVVDKGTGLEAVCAELDLAPETFL
                    :          *  :*      : *:** :***:.   : *. .:  :   *   .  *:

1119|gene|hla       AIGDSENDVSTFAVAGESYAVANADGAAREAADIVVADSYMDGTAGVLADLRTRTE-
2676|hp|hwa         AIGDSENDVSTFAVAGRSYAVGNADDAAQRAADEILENSYFDGTASVLDRIESSETS
16930|gene|hbo      AVGDSTNDTSTFGVVGQSYAVANADEAAKAAADEVLSASYMDGTLSVLESIQE----
718|chp|nrc1        AVGDSANDVELFEAVGESYAVGNADDHAKGAAETVLSETHGDGFLAAVDRIRS----
1738|hp|nph         AIGDSENDAELLELAGTGFAVANADAHARGAADAVTDASFADGFLEALDRARDNR--
1156|gene|hut       AVGDSTNDVSTFEAAGTAIAVANADDAALAAADHVTDAEFADGFLEALDRVDAGEW-
11620|gene|hma      AVGDSVNDAQMFDLAGEAVAVANADETALERADRVTDASYGDGFLEAVAPYRD----
2162|gene|hhi       AVGDSVNDAQMFDLAGEAVAVANADETALERADRVTDGTYGDGFLEAVAPYRE----
                    *:*** **.. :  .* . **.***  *   *: :    . **   .: