HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0591COG0311KOG3210arCOG00034Predicted glutamine amidotransferase involved in pyridoxine biosynthesisimidazoleglycerol-phosphate synthase

HOG Organism Gene ID Name Annotation
cHOG0591 nrc1 VNG2598 hisH1 imidazoleglycerol-phosphate synthase
cHOG0591 hmu HMUK0551 Hmuk_0551 SNO glutamine amidotransferase( EC:2.6.- )
cHOG0591 hma RRNAC2369 hisH1 glutamine amidotransferase subunit PdxT
cHOG0591 hwa HQ1301A hisH glutamine amidotransferase subunit PdxT
cHOG0591 hla HLAC0370 Hlac_370 SNO glutamine amidotransferase
cHOG0591 hbo HBOR27580 Hbor_27580 pyridoxal phosphate synthase yaaE subunit( EC:2.6.- )
cHOG0591 hut HUTA1409 Huta_1409 SNO glutamine amidotransferase
cHOG0591 hvo HVO_0436 HVO_0436 hisH imidazoleglycerol-phosphate synthase
cHOG0591 nph NP0464A glutamine amidotransferase subunit PdxT
cHOG0591 hhi 2808 hisH2 glutamine amidotransferase subunit PdxT
MUSCLE (3.6) multiple sequence alignment


464|gene|nph        -MLKAGVIAVQGDVAEHADAIRRAADRHGEDCTVESIRSAGVVPECDLLLLPGGESTTIS
370|gene|hla        --MQAGVIAVQGDVAEHAAAVENAAAAHGEPAEVVEVRDAGIVPDCDVLLMPGGESTTIS
1301|gene|hwa       -MIQAGVVAVQGDVSEHAAAIRRAGESHSISVEIVEIRQSGVVPDCDVLLIPGGESTAIS
1409|gene|hut       MTITAGVIAVQGDVSEHATAVEAAAAAHDQTTEIVEIRDSGRVPDCDVLLVPGGESTTIS
12369|gene|hma      MTLRAGVLAVQGDVSEHGDAIERAAAAHDRTAEVVEIREAGLVPDCDVLLLPGGESTTIS
2808|gene|hhi       MTLRAGVLAVQGDVSEHGDAIRRAAAAHDQTAEVVEIRESGVVPDCDVLLLPGGESTTIS
2598|gene|nrc1      MTLTAGVVAVQGDVSEHAAAIRRAADAHGQPADVREIRTAGVVPECDVLLLPGGESTAIS
27580|gene|hbo      -MIHAGVVAVQGDVSEHAAAIRRAADAHGENVDVVEIRQSGHIPDCDVLLIPGGESTAIS
                      : ***:******:**. *:  *.  *.    : .:* :* :*:**:**:******:**

464|gene|nph        RLLAEEGIDEEIEAFAAAGKPLLATCAGLIVASRDAKDDRVSTLDILDVSVDRNAFGRQK
370|gene|hla        RLIRREGIDEEIREHVASGKPVLATCAGLIVCSRDAKDDRVDALGLVNVSVDRNAFGRQK
1301|gene|hwa       RLLDREGIDTEIQAHVEAGKPVLATCAGLIIAARDAKDDRVETLDIIDVTVDRNAFGRQI
1409|gene|hut       RLLAEEGIAPEIRDHVAAGKPMLATCAGLIVAARDAGDDRVETLDVLDVAVERNAFGRQK
12369|gene|hma      RLIHREGIAEEIESHVEAGKPVLATCAGLIVSATDAQDDRVDTLNVIDVSVERNAFGRQR
2808|gene|hhi       RLIHREGIADEIQSHVDAGKPVLATCAGLIVSASDAQDDRVDTLNVIDVSVERNAFGRQK
2598|gene|nrc1      RLLDREGIDAEIRSHVAAGKPLLATCAGLIVSSTDANDDRVETLDVLDVTVDRNAFGRQV
27580|gene|hbo      RLLRREGIDEEIRDHVAAGKPVLATCAGLIVSSRDAKDDRVETLDLIDVSVDRNAFGRQV
                    **:  ***  **  .. :***:********:.: ** ****.:*.:::*:*:******* 

464|gene|nph        DSFEAAIDVEGLDEPFPAVFIRAPLIDEVDAAVETLAAVDDRPVAVRQDNVVGTSFHPEL
370|gene|hla        DSFEAKIPMTGLDEPFHAVFIRAPLIDDVGEGVEVLATVDGRPVAVRDGPVVATAFHPEL
1301|gene|hwa       DSFEAPLDVDGLDEPFPAVFIRAPVIDAAGEDATVLAQWEDNPVAVQDGAVVATAFHPEL
1409|gene|hut       DSFEAPLDVDGLDDPFHAVFIRAPVIEEVG-DADVLATWEGRPVAVRDGPVVGTAFHPEL
12369|gene|hma      DSFEAPLDVTGLNESFPAVFIRAPVIDYVGEDVEVLATWDDRPVAVRDGPVVGTSFHPEL
2808|gene|hhi       DSFEAPLAVEGLDDPFPAVFIRAPVIDYVGTDVEVLATWDDHPVAVREGPVVGTSFHPEL
2598|gene|nrc1      DSFEAPLDVDGLADPFPAVFIRAPVIDEVGADATVLASWDGRPVAIRDGPVVATSFHPEL
27580|gene|hbo      DSFEAPLDIAGMDDPFPAVFIRAPLIDDVDDGVEVLAEWDGTPVAVRQGPVVGTSFHPEL
                    ***** : : *: :.* *******:*: ..  . .**  :. ***:.:. **.*:*****

464|gene|nph        TDDSRIHGLAFFS-------------
370|gene|hla        TDDSRIHDLAFFPEQEVVA-------
1301|gene|hwa       TPDSRIHDLAFFANQNNNVDTAVSTD
1409|gene|hut       TGDHRIHDLAFFE-------------
12369|gene|hma      TEDPRIHDLAFFDSVES---------
2808|gene|hhi       TEDPRIHDLAFFDSVES---------
2598|gene|nrc1      TADVRLHELAFFDRTPSAQAGDA---
27580|gene|hbo      TADSRLHDLAFFDHVEAEAAD-----
                    * * *:* ****