HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0590COG1432arCOG02408Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0590 nrc1 VNG0419 vng419 no entry
cHOG0590 hmu HMUK3179 Hmuk_3179 protein of unknown function DUF88
cHOG0590 hma RRNAC0208 hypothetical protein
cHOG0590 hwa HQ1506A hypothetical protein
cHOG0590 hla HLAC0673 Hlac_673 protein of unknown function DUF88
cHOG0590 hbo HBOR22910 Hbor_22910 uncharacterized conserved protein
cHOG0590 hut HUTA0224 Huta_0224 protein of unknown function DUF88
cHOG0590 hvo HVO_1102 HVO_1102 Uncharacterized conserved protein
cHOG0590 nph NP4076A hypothetical protein
cHOG0590 hhi 955 HAH_0955 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4076|hp|nph       MPPIHSNQRVAVLADSQNLYHTAHSYYSRNPDYTELLSAAVRDRELIRAIAYVIRADPPT
224|hp|hut        MTDVHPGQRVAVLADSQNLYHTAQSLYQQNIDYGELLDAAVRDRQLTRAIAYVIRADADD
10208|hp|hma      MTVSQPGQRVAVLADAQNLYHTARSLYSRNIDYEALLEEAVDGRELTRAIAYVIRADSPE
955|hp|hhi        MTVSQPGQRVAVLADAQNLYHTARSLYSRNIDYEALLEEAVDGRELTRAIAYVIRADSPE
419|chp|nrc1      MPPLQPAQRVAVLADSQNLYHSAQSVYSQNIDYAALLDKGVQDRELTRAIAYVIRAQSED
673|gene|hla      MTEIHPDQRVAVLADSQNLYHSAQSVYSRNIDYSGLLEEAVNDRSLVRAIAYVIRADSPE
1506|hp|hwa       MTEIHPGQRVAVLADAQNLYHTAQSLYSQKIDYGSLLKKGVSGRELTRAIAYVIQADAPE
22910|hp|hbo      MTEIHPGQRVAILADAQNLYHSAQSLYSRNIDYSSLLEKGVSDRTLTRAIAYVVRADSPE
                  *.  :. ****:***:*****:*.* *..: **  **. .* .* * ******:.*:.  

4076|hp|nph       EQEFFEALRDIGFETKIKDIKTFADGTQKANWDLGMCLDAVTLAPKIDTFVLASGDGDFA
224|hp|hut        EERFFDALEDIGFETKAKDIKTFADGSKKADWDVGMSLDAVTLAPHVDTIALCTGDGDFA
10208|hp|hma      EESFFEALVDIGFETRIKDIKTFQDGSKKADWDVGMSLDAVSLANHVDTVVLCTGDGDFA
955|hp|hhi        EESFFEALVDIGFETRIKDIKTFQDGSKKADWDVGMSLDAVSLANHVDTVVLCTGDGDFA
419|chp|nrc1      EDRFFDALRDIGFETKIKAIKTFGDGSKKADWDVGMSLDAVSLADHIDTIVLCTGDGDFS
673|gene|hla      EESFFEALRDIGFETKIKEIKTFADGSKKADWDLGMSLDAVSLASHVDTVVICTGDGDFA
1506|hp|hwa       EETFFEALVDIGFEPKIKQIKTFGDGTKKADWDVGMSLDAVTLANHVDTVVLCTGDGDFS
22910|hp|hbo      EESFFDALVEIGFETKIKDIKTFGDGSKKADWDVGMSLDAVTLANHVDTVVLCTGDGDFS
                  *: **:** :****.. * **** **::**:**:**.****:** ::**..:.:*****:

4076|hp|nph       RLCTHLRHEGVRTEVFGFGDSTAEELIDAADSYVDMSEDEDRFLL
224|hp|hut        RLVTHVRHEGVRVEVLSFGESTSEELLDVAEDYTDLSEDTERFLL
10208|hp|hma      RVCRYLRHEGCRVEAMGFEESSSEDLKAAVDGFIDMSDDSDRFLL
955|hp|hhi        RVCRYLRHEGCRVEAMGFEESSSEDLKAAVDGFIDMSDDSDRFLL
419|chp|nrc1      RLCRHLRHEGVRVEVMAFEESAATELVDAADSFVDLSERTETFLL
673|gene|hla      RLCSHLRHEGVRVEAMGFGNSAADELIDAADDFVDLAEHEETFLL
1506|hp|hwa       RLCSHLRHEGVRVEVMSFRESTADELVDAADTFIDLSARQETFLL
22910|hp|hbo      RLCSHLRHEGVRVEVIAFKESTADELIEAADTFLDMSDRQETFLL
                  *:  ::**** *.*.:.* :*:: :*  ..: : *::   : ***