HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0059arCOG03029/1hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0059 nrc1 VNG2335 vng2335 no entry
tucHOG0059 hmu HMUK2001 Hmuk_2001 conserved hypothetical protein
tucHOG0059 hmu HMUK1246 Hmuk_1246 conserved hypothetical protein
tucHOG0059 hma RRNAC1190 hypothetical protein
tucHOG0059 hma RRNAC3097 hypothetical protein
tucHOG0059 hwa HQ1907A hypothetical protein
tucHOG0059 hwa HQ3466A hypothetical protein
tucHOG0059 hla HLAC0147 Hlac_147 hypothetical protein
tucHOG0059 hbo HBOR01550 Hbor_01550 hypothetical protein
tucHOG0059 hut HUTA0900 Huta_0900 conserved hypothetical protein
tucHOG0059 hvo HVO_0071 HVO_0071 conserved hypothetical protein
tucHOG0059 nph NP0952A hypothetical protein
tucHOG0059 hhi 1791 HAH_1791 hypothetical protein
tucHOG0059 hhi 348 HAH_0348 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1907|hp|hwa       ------------------------------------------------------------
11190|hp|hma      ------------------------------------------------------------
1791|hp|hhi       ------------------------------------------------------------
2335|hp|nrc1      MLYCSGGPGWHGDYDGNRARSGVQPRGSQPASTGAPGVRVILRSGQRRSGCTRATGRQDA
900|chp|hut       ------------------------------------------------------------
952|hp|nph        ------------------------------------------------------------
1550|hp|hbo       ------------------------------------------------------------
147|hp|hla        ------------------------------------------------------------
3466|hp|hwa       ------------------------------------------------------------
71|hp|hvo         ------------------------------------------------------------
13097|hp|hma      ------------------------------------------------------------
348|hp|hhi        ------------------------------------------------------------
                                                                              

1907|hp|hwa       ------------------------------------------------------------
11190|hp|hma      ------------------------------------------------------------
1791|hp|hhi       ------------------------------------------------------------
2335|hp|nrc1      SIGLEPPTWGLAPSRAWRTRLRPTASHKPIPTIQNGPTGGRTRAVVRTDDGWTRRPPSTP
900|chp|hut       ------------------------------------------------------------
952|hp|nph        ------------------------------------------------------------
1550|hp|hbo       ------------------------------------------------------------
147|hp|hla        ------------------------------------------------------------
3466|hp|hwa       ------------------------------------------------------------
71|hp|hvo         ------------------------------------------------------------
13097|hp|hma      ------------------------------------------------------------
348|hp|hhi        ------------------------------------------------------------
                                                                              

1907|hp|hwa       ----------------------------MTKFDPEKFDN-KYEHYFEEIEQAYSDAYQQL
11190|hp|hma      ----------------------------MTEFDAEKFDE-KYVHYFEELETAYSNAYQEL
1791|hp|hhi       ----------------------------MTEFDAEKFDE-KYVHYFEELETAYSNAYQEL
2335|hp|nrc1      KAGSHPPAGVLCAGGSDGHLQAGVQTTSMSDLTPEEFEEQKYVDYFPKLETAYKRAFDDM
900|chp|hut       ----------------------------MTEFDPDRFTD-KYEHYFTELQQAYRRAFEAM
952|hp|nph        -------------------------------MDAETFDEQKYVDLFPQLQQAYKNVFNRL
1550|hp|hbo       ----------------------------MADFDPEKFED-KYVHYFPQLQRAYKNAFNTM
147|hp|hla        ---------------------------MADEFDPEKFED-KYAHYFNELQRAYKNAFNQM
3466|hp|hwa       ----------------------------MAEFDPEQFED-KYANYFAELQRAYKNAFESM
71|hp|hvo         ----LLYKIHNSDELTVRFFAGSAKAPSMTEFDPEKFED-KYANYFPELQRAYKNAFETM
13097|hp|hma      ----------------------------MTTFDPEKFED-KYANYFPELQKAYKNAFERM
348|hp|hhi        ----------------------------MTEFDPEKFED-KYANYFPELQKAYKNAFERM
                                                 : .: * : **   * ::: **  .:: :

1907|hp|hwa       HGGCDSEILRAIDRKVLSESEPLYEG-NGKFHVRLPDDIDERAQP-LPGDEESFNAVLDE
11190|hp|hma      HGQYDSEVLRGIDRQILSESEPVYEG-NGTFSIRLPDDTAARAQS-LPGDEATFDTVLSA
1791|hp|hhi       HGQYDSEVLRGIDRQILSESEPVYEG-DGTFSIRLPDDTAARAQS-LPGDEATFDTVLSA
2335|hp|nrc1      NGTYDRKLVHAIDQQVLSESEPFYEA-DSGFSVELPADPLDRLAG-VQVDADHARDVIDE
900|chp|hut       SERHDSDLIHGIDQRILAESEPFYEG-DGEFRIDLPDDASDRLPD---VDADRLETVLGE
952|hp|nph        NEEYDSTLIHAIDQQVLNESEPFYDDDAEGFYVELPDDPYDRLTG-VAVEEETFESVLET
1550|hp|hbo       NEEYDSTLIHAIDQQILNESEPMYE--DGDFHIQLPENPSERLTG-VVVEDEKLDAVLDR
147|hp|hla        NDRYDSELIHGIDQTVLNESEPFYE--DGEFRVELPENPRERIRGAVPVDDELFKEALNE
3466|hp|hwa       NNRYDSELIHAIDQQILNESEPFYDTETDSFEIQLPENPTDRLTA-IVVDDQKLQTVLET
71|hp|hvo         NDEFDSSLIHGVDQQILNESEPFYD--DGDFSVQLPDDPAERLTA-VEIDDDELDAVLDR
13097|hp|hma      NDTYDSELVHAIDQQILNESEPFYD--DGEFSVELPENPTERLSA-VIVDDEKLDAVLSE
348|hp|hhi        NDAYDSELVHAIDQQVLNESEPFYE--DGEFSVELPENPTERLSA-IIVDDEKLDAVLSE
                      *  ::..:*. :* ****.*:     * : ** :   *       :      .:  

1907|hp|hwa       FTTRIEHELHNLFVFEFEE----
11190|hp|hma      FTDAIERELRRLFEFE-------
1791|hp|hhi       FTDAIERELCRLFEFE-------
2335|hp|nrc1      HTDRICVHLRDQFGIGGQADEKA
900|chp|hut       YTGELETQLRSVFDFEEAW----
952|hp|nph        YIGELEAELERTFGE--------
1550|hp|hbo       YLDELVAEHRRIFGLNG------
147|hp|hla        YVDRIESELYRTLGVDRPE----
3466|hp|hwa       YVDELQQQHRRVFGLDDESEPKV
71|hp|hvo         YVDEIESELRRVFGVEA------
13097|hp|hma      YVDEIERELRRVFDIDD------
348|hp|hhi        YVDEIERELRRVFDIDD------
                  .   :       :