HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0589COG1500KOG2917arCOG04187Predicted exosome subunithypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0589 nrc1 VNG1276 vng1276 no entry
cHOG0589 hmu HMUK2402 Hmuk_2402 Shwachman-Bodian-Diamond syndrome protein
cHOG0589 hma RRNAC1173 putative RNA-associated protein
cHOG0589 hwa HQ2517A putative RNA-associated protein
cHOG0589 hla HLAC0849 Hlac_849 Shwachman-Bodian-Diamond syndrome protein
cHOG0589 hbo HBOR18900 Hbor_18900 conserved hypothetical protein TIGR00291
cHOG0589 hut HUTA2806 Huta_2806 Shwachman-Bodian-Diamond syndrome protein
cHOG0589 hvo HVO_1344 HVO_1344 conserved hypothetical protein TIGR00291
cHOG0589 nph NP3740A putative RNA-associated protein
cHOG0589 hhi 1775 HAH_1775 putative RNA-associated protein
MUSCLE (3.6) multiple sequence alignment


1276|chp|nrc1       MISLDDAVTARLETHGERFEVLVDPDAALEMRRDEFDGELTDVIAARDVFENASRGDRPA
849|gene|hla        MISLDEAVTARLESHGERFEVLIDPDAALAMKRGEFEGNLEDVIAAEDVFENASRGDRPA
2517|gene|hwa       MISLDEAVTARLESHGERFEVLIDPDAALEMKRDEFDDDIEDVIAAEDVFENAARGDRPA
18900|chp|hbo       MISLDEAVTARLESHGERFEVLIDPDAALAIKRGEFEGDLEEVIAAEDVFEDASRGDRPA
3740|gene|nph       MISLDEAVTARLESHGERFEVLVDPDAALSIKRGEFDGDLEDVIAAEDVFEDASSGDRPP
2806|gene|hut       MISLDEAVTARLETHGERFEVLVDPDAALSMKRDDFDGDLEDVIAAEDVFENASRGDRPP
11173|gene|hma      MISLDEAVTARLESHGQRFEVLVDPDAALAIKRDDFDDDLEDVIAAEDVFEDASRGDRPP
1775|gene|hhi       MISLDEAVTARLESHGQRFEVLVDPDAALAIKRDDFDGDLEDVIAAEDVFEDASRGDRPP
                    *****:*******:**:*****:****** :.*.:*:.:: :**** ****:*: ****.

1276|chp|nrc1       ESDLETVFGTTEPLEIIPEVIGQGEIQITADQREAMQQRKKRSLINTISRNAINPQMDGA
849|gene|hla        EEDLETVFGTTDPLEIIPEVVERGEIQITAEQREEMMERKHNQLVTTITRNAVNPQMDDS
2517|gene|hwa       EEDLKAVFETTEPLSIIPTVVKDGEIQITAEQRREMQEQKRKQLINQIARNAVNPQMDNA
18900|chp|hbo       ENDLETVFETTDPMEIIPEVVKRGEIQITAEQRREMQEQKRKQLINTIARNAVNPQMDNA
3740|gene|nph       ESALEEVFETTDPLEIIPAVIKRGEIQITAEQRRKMQEQKHNQLVNKIARNAVNPQMDDA
2806|gene|hut       ENALEEVFGTTEPLEIIPEVIQDGEIQITADQRREMQERKHRELVQRITRNAVNPQMDDA
11173|gene|hma      ENMLEEVFDTTEPMAIIPEVIKRGEIQITADQRREMQEQKHKQLIQRITRNAVNPQMDDA
1775|gene|hhi       ENMLEEVFDTTDPMAIIPEVIKRGEIQITADQRREMQEQKHKQLIQRITRNAVNPQMDDA
                    *. *: ** **:*: *** *:  *******:**  * :.*...*:  *:***:*****.:

1276|chp|nrc1       PHPPDRIESALDEAGFTVDPMTPADEQVDDALEALRPVIPIRFEEMTVAVQLPADYAGSG
849|gene|hla        PHPPERIERALEEAGFQIDPMEPVENQVDDALEALRPVIPIRFEEVTMAVQLPADYAGSG
2517|gene|hwa       PHPPERIERALEEAGFRVDPMEPVESQIDDALDDLRPVIPIRFDEVTVAVQVPASDAGKT
18900|chp|hbo       PHPPERIERALEEAGFKVDPMEKVESQVDEALDALRPVIPIRFDEVTVAVQIPADYAGKT
3740|gene|nph       PHPPERIERALEEAGFQVDPMEPVENQVDEALDDLRPVIPIRFDEVVMAVQVPADYAGSA
2806|gene|hut       PHPPDRIESALEEAGFQIDPMEPVETQVDDALDALRPVIPIRFDEVTVAVQLPPDYAGSG
11173|gene|hma      PHPPERIESALEETDFRVDPMEPVEAQVDDALDALRPVIPIRFDEVTVAVQVPADYAGSA
1775|gene|hhi       PHPPERIESALEETDFRVDPMEPVEAQVDDALDALRPVIPIRFDEVTVAVQVPADYAGSA
                    ****:*** **:*:.* :***  .: *:*:**: *********:*:.:***:*.. **. 

1276|chp|nrc1       QAKLREFGELEREEWQADGSWVGVITFPAGMQDEFYGRVNEVSEGNGETSVVKDKDELKT
849|gene|hla        QAQIREFGDLEREEWQNDGSWVGVLTFPAGLQNDLYDLVNEVTSGEGDARVIKDKDELRT
2517|gene|hwa       QAQVREYGDLEREEWQPDGSWVGVVTFPAGMQNDFYDLVNELTSGEAETRILKNKDEIST
18900|chp|hbo       QAQVREYGDLEREEWQNDGSWVGVVTFPAGLQNDFYDMVNEYTSGEAETRIVKDKDELST
3740|gene|nph       QAQIRQFGELQSEEWQSDGSWVGVLKFPAGLQNEFYDLVNEHTSGEAETRTVKDEDEIGT
2806|gene|hut       QAKIREFGDLESEEWQSDGSWVGVLTFPAGLQNDFFELANEVSSGEAETRIIKDEDDIKT
11173|gene|hma      QAQIRQFGDLEREEWQSDGSWVGVMTFPAGLQNDFYDVVNEHTSGEAETRIIKDEDDIST
1775|gene|hhi       QAQIRQFGDLEREEWQSDGSWVGVMTFPAGLQNDFYDVVNEHTSGEAETQIIKDEDDIST
                    **::*::*:*: **** *******:.****:*::::  .** :.*:.::  :*::*:: *

1276|chp|nrc1       R-
849|gene|hla        R-
2517|gene|hwa       R-
18900|chp|hbo       R-
3740|gene|nph       R-
2806|gene|hut       R-
11173|gene|hma      RG
1775|gene|hhi       R-
                    *