HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0588COG3252arCOG02675Methenyltetrahydromethanopterin cyclohydrolaseN5.N10-methenyltetrahydromethanopterin cyclohydrolase

HOG Organism Gene ID Name Annotation
cHOG0588 nrc1 VNG1686 mch N5.N10-methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 hmu HMUK1816 Hmuk_1816 methenyltetrahydromethanopterin cyclohydrolase( EC:3.5.4.27 )
cHOG0588 hma RRNAC1616 mch N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 hwa HQ2798A mch N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 hla HLAC1693 Hlac_1693 methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 hbo HBOR10140 Hbor_10140 methenyltetrahydromethanopterin cyclohydrolase( EC:3.5.4.27 )
cHOG0588 hut HUTA1145 Huta_1145 methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 hvo HVO_2573 HVO_2573 N(5)N(10)-methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 nph NP2634A mch N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase
cHOG0588 hhi 2159 mch N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase
MUSCLE (3.6) multiple sequence alignment


1686|gene|nrc1      MESLNRMALELADEALEFTEELDIGAFELDTGTTVIDFGVEHDGGLEAGLLLAELQTAGL
11616|gene|hma      MDSLNRMATELVDEAIDFADELTIDVHALEGDAAVLDFGVEVPGAVEAGMLLAEIQTAGL
2159|gene|hhi       MDSLNRMATELVDEAIDFADELTIDVHALEGDAAVLDFGVEVPGAVEAGMLLAEIQTAGL
1693|gene|hla       MESINRTAIELVDEALDFAGELDVVGYELDNGATVVDFGIDAAGGVEAGLLLAEIQTAGL
2798|gene|hwa       MDSINRMAVELVDEAIDFAEELRIVPQELDSGARVLDFGVNAEGGVEAGLLLAEIQTAGL
10140|gene|hbo      MDSINRMAIELVDEAIDFADELRVDVYELDTGATVLDFGVNAEGGIEAGLLLSEIETAGL
1145|gene|hut       MDQLNRLGTELVDEAIDFADELGIAEYRLDNETTVLDFGVEHAGGVEAGLMLTEIQTAGL
2634|gene|nph       MESLNRMAVELVDEAVDFADELAIEIEELDNGAMVCDFGVEATGGIEAGLLLTEIQTGGL
                    *:.:** . **.***::*: ** :    *:  : * ***::  *.:***::*:*::*.**

1686|gene|nrc1      ATVQTRVDTVGDATFPHVEVACDQPAVAMLGAQKAGWELAVDD--YEALGSGPARALVAT
11616|gene|hma      ATVQSTMATVGGAPLNHVELSTDHPALALLCSQKGGWELAVDD--FQALGSGPARALVAE
2159|gene|hhi       ATVQSTMATVDGAPLNHVELSTDHPALALLCSQKGGWELTVDD--FQALGSGPARALVAE
1693|gene|hla       ANLRTRMGEVAGAPRQYVELSTDHPAIALLCSQKAGWELAFDS-GFEGLGSGPARALVGQ
2798|gene|hwa       ATVQTRMDEIAGVQTPHVEVQTDHPAVALLCSQKAGWELEFDDPTFEGLGAGPARALVAE
10140|gene|hbo      ATIQSQMGDVAGAPRPYIEVQTDHPALALLCSQKAGWELAFES-GFEGLGSGPARALVAE
1145|gene|hut       ASVTTRLESVGDAALPHVEVTTDHPALALLAGQKAGWELATED--FEGLGSGPARALVAR
2634|gene|nph       ATVQTTVGEVADAPLTHVEVSSDHPGIAFLAAQKAGWEISVDG--FEGLGSGPARALVAE
                    *.: : :  : ..   ::*:  *:*.:*:* .**.***:  :.  ::.**:*******. 

1686|gene|nrc1      EGEFQAIDYVDAFEFAVLTLESTGLPTTAAASEVAARAGVTEESVFLPTYRTASVAGSVS
11616|gene|hma      EEAFQRIGYREDADFAVLAVETDELPDEDVASQVAERTGVPETGVFLPSFATASVTGSVV
2159|gene|hhi       EEAFQRIGYREDADFAVLALETDELPDEDVASQVAERTGVPETGVFLPSFATASVTGSVV
1693|gene|hla       EAEFERVGYYDSSEFATLTVESTTLPTEEVAEHVADLAEVEAEGVFLPAYATGSTAGSVA
2798|gene|hwa       EDEFQALEYFDEFDLAVLSVESISLPSETVIEHVANKTDVNLSGVMLPTYATGSVVGSVT
10140|gene|hbo      EDEFHQVEYFDEFDLTVLGVESIELPDDEVAEHVAETAGVEPSGVFLPTYATGSTVGSVT
1145|gene|hut       EDIFERLEYVEAFDFAVLAVESDALPTEAAAAQVADLAGVPESSVFLPAFSTASITGSVA
2634|gene|nph       EEEHQRLGYRDAADFAVLAIESDRLPTEAVAEQVAERAGVPTSSVFLPTFSTASITGSVA
                    *  .  : * :  :::.* :*:  **   .   **  : *   .*:**:: *.* .*** 

1686|gene|nrc1      AAARTVELAVFRLYELGYDPTDVLSASGCAPVAPVAGDEQTAIGRTNDALAHGGRVHLTV
11616|gene|hma      AAARAAELAVFRLAELGFDPVSVLSASGRAPVAPVADDEATAMARTTDALAYGSEVHLTV
2159|gene|hhi       AAARAAELAVFRLAELGFDPVSVLSASGRAPVAPVAGDEATAMARTTDALAYGSEVHLTV
1693|gene|hla       TAARAAELAVFRLLELGYEPTDVLHASGAAPMAPATRDEDLAMGRTNDALAYGGEVHLQV
2798|gene|hwa       AAARAAELALFRLFELGYDVRNVHSAFGSAPIAPISYDESIAMGRTNDALAYGGTVHLTV
10140|gene|hbo      AAARAAELAVFRLFELGYDPRKILSAFGAAPVAPVSYDEGVAMGRTNDALAYGGEVHLTV
1145|gene|hut       AGARASESAVFQLFELGYDPEDVHSVSGVAPVAPVAESEEAAIARTNDALAYGGRVHLTV
2634|gene|nph       LAARAGELAAFRLSELGYDPLDMLSATASAPVAPIAGDDETAMARTNDALAYGGRVHLTV
                     .**: * * *.* ***::  .:  . . **:** : .:  *:.**.****:*. *** *

1686|gene|nrc1      AEDFDAFDAVVSSAAARYDDPFAEVVGTDDWDAGDVDNGVFGPAQLTVDVVGGPTHAFGT
11616|gene|hma      DESFDRFDEVPSVAAREYGEPLEGVFEDVDWDFAELPVELFGPAAVTIDVVGGDTHVVGE
2159|gene|hhi       DESFDRFDQVPSVAAEEYGEPLEGVFEDVGWDFAELPVELFGPAAVTIDVVGGDTHVVGG
1693|gene|hla       ARDDDRFDQIVSTAREEYGTPFVEVFEDADWDFYEVDERVFAPAKVTVDVVDGPVYTVGE
2798|gene|hwa       TADDPVLKELPSTARDKYGTPFEEIFAEADWDFYDVPESVFAPAQVTVDVIDGPTHVLGE
10140|gene|hbo      TEDFDDFDEVPSTAGEEYGTPFEQIFEEADWDFYDIPATVFAPAKVTIDVVNGPTYVHGE
1145|gene|hut       ESGFDRFEEIPSTAGEEYSQPFAEIFEDADWDFEELPADVFGPAQVTVDVIGGETAVYGE
2634|gene|nph       DSDFERLSEATSTASDEFGTPFADIFESHEWDFQDLPVEVFAPAQVTFDVAGGGLDVVGE
                      .   :.   * *   :. *:  :.    **  ::   :*.** :*.** .*   . * 

1686|gene|nrc1      VREDVLADGFGLS--
11616|gene|hma      TSEDVLAESFGL---
2159|gene|hhi       TSEGVLAESFGL---
1693|gene|hla       TDEELLAESFGYR--
2798|gene|hwa       TNEELVAESFEY---
10140|gene|hbo      TDEEILAESFGIQP-
1145|gene|hut       TDEALLVESFGL---
2634|gene|nph       LNEELLAESFGIESA
                      * ::.:.*