HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0584COG1257KOG2480arCOG04260Hydroxymethylglutaryl-CoA reductase3-hydroxy-3-methylglutaryl-coenzyme A reductase

HOG Organism Gene ID Name Annotation
cHOG0584 nrc1 VNG1875 mvaA 3-hydroxy-3-methylglutaryl-coenzyme A reductase
cHOG0584 hmu HMUK1499 Hmuk_1499 3-hydroxy-3-methylglutaryl Coenzyme A reductase( EC:1.1.1.34 )
cHOG0584 hma RRNAC3412 mvaA 3-hydroxy-3-methylglutaryl-coenzyme A reductase
cHOG0584 hwa HQ3215A hmgR hydroxymethylglutaryl-CoA reductase (NADPH)
cHOG0584 hla HLAC2019 Hlac_2019 3-hydroxy-3-methylglutaryl Coenzyme A reductase
cHOG0584 hbo HBOR10010 Hbor_10010 3-hydroxy-3-methylglutaryl-coenzyme A reductase( EC:1.1.1.34 )
cHOG0584 hut HUTA0276 Huta_0276 3-hydroxy-3-methylglutaryl Coenzyme A reductase
cHOG0584 hvo HVO_2583 HVO_2583 hmgA 3-hydroxy-3-methylglutaryl Coenzyme A reductase
cHOG0584 nph NP2422A mvaA_1 hydroxymethylglutaryl-CoA reductase (NADPH) 1
cHOG0584 hhi 640 hmg 3-hydroxy-3-methylglutaryl-coenzyme A reductase
MUSCLE (3.6) multiple sequence alignment


1875|gene|nrc1      MPDDASD----LADRVQAGDLRLYELD--DETDADTAAAARRAVLERETDADTDALGAFA
276|gene|hut        MAAVTD-----LVERLRSGELRLYELE--DIADPDDATAARREYVETEADADLETVGSYS
3215|gene|hwa       MPDPTT-----LANSVQTGECRLHELTDIDDVDADTAAAARRLIVEEQADIALDAVSDYG
2019|gene|hla       MTEPTPAS---LADRVSEGEIRFHELE--AHADANTAAAARRRLVSETADADVDALGEYA
10010|gene|hbo      MTDSTPSAAEDLAERVRAGELRFHELE--DHTDADTATAARRLLVEEQSDASLDVVGDYG
2422|gene|nph       -MDTDA-----LVDAVRDGELRLHELE--AHADADTAAAARRRIVADAADTSLETVGEYA
13412|gene|hma      MTDSDVVA---LAERVRDGELRLYELE--DHAEPDVAAAARRHLLAEETDTDLSAVGDYT
640|gene|hhi        MTDSDATA---LAERVRDGELRLYELE--DHADPDTAAAARRHLLAEETGADLSAVGDYT
                               *.: :  *: *::**     .:.: *:****  :   :.   ..:. : 

1875|gene|nrc1      FDADQAADTAVENLTGGAQLPLGVAGPVALSGGAADGEYYLPMATTEGALVASVNRGCSA
276|gene|hut        IDAADAE-PNIENMIGTVQIPMGVTGPLPVDGEAADGEYTVPLATTEGALVASVNRGVTA
3215|gene|hwa       FPAAEAT-ANIENMIGTIDIPIGVAGPVIVNGGALTGKRYLPLATTEGALLASVNRGCTV
2019|gene|hla       FDAADAHGSNIENMVGAVQVPMGVAGPVAVDGGALSGERYLPMATTEGALVASINRGCSV
10010|gene|hbo      FPAERAD-PNIENMVGAVQVPMGVAGPVRIRGGRLDGERYLPLATTEGALLASVNRGCSV
2422|gene|nph       FPADDAE-PNIENMVGAAQVPMGVVGPLAVDGDAIDGEPYLPLATTEGALVASVNRGCAS
13412|gene|hma      FDAADAE-SNIENMVGAAQVPMGVVGPLPVDGGAAEGDHHLPLATSEGALLASVNRGVST
640|gene|hhi        FDAADAE-SNIENMVGAVQVPMGVVGPLPVDGGAAEGDHHLPLATSEGALLASVNRGVST
                    : *  *  . :**: *  ::*:**.**: : *    *.  :*:**:****:**:*** : 

1875|gene|nrc1      ITAAGGANARVTKTGMTRAPVFRVADVTEGAEVAQWADDNTDALAAAAESTTSHGELTDV
276|gene|hut        IRDAGGSTARIMKSGITRAPVFSVADVGEAKAVAEWVRENEAELAAVAEDTDPHIAFEDV
3215|gene|hwa       LSAAGGAVARVMKSGMSRAPVFRVDNVVTAKALVEWVRDNIDSLRDAAEETTNHGELESV
2019|gene|hla       VNDAGGATARVTKSGMTRAPIFRVADVAEAEALVSWVRDNEGVLREAAESTTSHGELLDV
10010|gene|hbo      LNDAGGANVRILKSGMTRAPVFRVADVVEAEALVEWVRDNRDALREAAEETTNHGELLDV
2422|gene|nph       MTAAGGATARVLKNAMTRAPVFRVAGVAEASETAAWVRDNVESLASAAEATTSHGELRDV
13412|gene|hma      IRNAGGATARVLKSGMTRAPVFRVEDVAEAGEVSAWVREHVDVLADAAESTTSHGELQDV
640|gene|hhi        IRNAGGATARVLKSGMTRAPVFRVEDVAKAGEVSAWVREHVDVLADAAESTTSHGELQDV
                    :  ***: .*: *..::***:* * .*  .     *. ::   *  .** *  *  : .*

1875|gene|nrc1      TPYVVGDNVYLRFRYDTKDAMGMNMATIATEAASELVEDETPAELVAVSGNLCTDKKPAA
276|gene|hut        TPYVVGDSVFLRFRYDTGDAMGMNMVTIASRAASELVEAETPAELVALSGNLCSDKKPAA
3215|gene|hwa       TPYAVGRSVYLRFRYDTKDAMGMNMATIATEAACEVVEKETDAELIALSGNLCTDKKPAA
2019|gene|hla       TPYVVGNNVYLRFRYDTKDAMGMNMVTIATREACDEIEAETDASLVALSGNLCSDKKPAA
10010|gene|hbo      TPYVVGNSVHLRFRYDTKDAMGMNMVTIATRAACELVEDETDASLVALSGNLCTDKKPAA
2422|gene|nph       TPYVVGDNVFLRFAYDTKDAMGMNMATIATEAACEVVEAETPAELVALSGNLCSDKKPAA
13412|gene|hma      TPYVVGDSVFLRFSYDTKDAMGMNMATIATEAACDVVETETPADLVALSGNLCSDKKPAA
640|gene|hhi        TPYVVGDSVFLRFSYDTKDAMGMNMATIATEAACDVVESETPADLVALSGNLCSDKKPAA
                    ***.** .*.*** *** *******.***:  *.: :* ** *.*:*:*****:******

1875|gene|nrc1      INAVEGRGRTVTADVTIPQDVVEERFDTTPAAIEEANTRKNLIGSAKAGSLGFNAHAANV
276|gene|hut        INSVEGRGYTVAADVFLPDDLVEDTFHATSEAIATVNTRKNLVGSAKAGSLGFNAHVANI
3215|gene|hwa       INAVEGRGRTVTADVTIPRETVVDRLHTTPSAVAELNTRKNLIGSAKAGSLGFNAHVANV
2019|gene|hla       INAVEGRGRSVAADVEVPREVVEERLHTTPESIAEINTRKNLVGSAKAGGLGFNAHVANA
10010|gene|hbo      INAVEGRGRSVTTDVTIPREVVEDRLHTTPEAVAELNTRKNLVGSAKAASLGFNAHVANV
2422|gene|nph       VNSVEGRGRTVAADVVLPGSVVEEYFGTTPAAIAEANTRKNLVGSAKAGSLGFNAHAANT
13412|gene|hma      INAVEGRGRTVAADVLIPHEQVEDRLDTTSDAIVEANTRKNLVGSAKAGALGFNAHAANV
640|gene|hhi        INAVEGRGRTVAADVLIPHEQVEERLDTTSDAIVEANTRKNLVGSAKAGALGFNAHTANV
                    :*:***** :*::** :* . * : : :*. ::   ******:*****..******.** 

1875|gene|nrc1      VAAVFLATGQDAAQVVEGANAITTVEAR-DDALYASVNLASLEVGTVGGGTTLPTQREAL
276|gene|hut        VGAAFLALGQDEAQVVEGSNAITSLEAR-EDGLYASVTLASLEVGTVGGGTALPTQSEAL
3215|gene|hwa       VAAMFIATGQDEAQVVEGANAITTAEVR-ENDLYMSVSIASLEVGTVGGGTTLPAQAEAL
2019|gene|hla       VAAMFLATGQDEAQVVEGANAITTAETTPEGDLYLSVSLASLEVGTVGGGTGLPTQAAGL
10010|gene|hbo      VAAMFLATGQDEAQVVEGANAITTAEVQ-DGDLYVSISIASLEVGTVGGGTKLPTQAEGL
2422|gene|nph       VAAAFLATGQDIAQVVEGANAITTADVR-DGDLYASLTLASLEVGTVGGGTKLPTQAEAL
13412|gene|hma      VAAAFLALGQDMAQVVEGSNAITTVDAR-EDGLYASVTIASLEVGTVGGGTGLPTQSEAL
640|gene|hhi        VAAAFLALGQDIAQVVEGSNAITTVDAR-EDGLYASVTIASLEVGTVGGGTGLPTQSEAL
                    *.* *:* *** ******:****: :.  :. ** *:.:************ **:*  .*

1875|gene|nrc1      DVLGVRGGGDPAGANADALAEIIAVGALAGEINLLAALASRRLSAAHADLGR-
276|gene|hut        SVLGLAGGGDPVGSNAEALAEIIATTALAGELSLLGALASRHLSSAHEELGR-
3215|gene|hwa       DMLGIRGGGTPPGSNADGLAECIATGALAGELSLLSALASRNLSTAHADLGRE
2019|gene|hla       DILGVRGGGDPAGSNGDALAEAIAVGALAGELSLLAALGSRHLSSAHADLGR-
10010|gene|hbo      DVLGVRGGGDPAGSNADALAEAIAVGSLAGELSLLSALASRHLSSAHAELGR-
2422|gene|nph       DVVGVRGGGDPAGSNADALAEAIATAALGGELSLLGALASNHLASAHEELGR-
13412|gene|hma      DVLGYSGGGDPAGSNADALAEVIAAGALAGELSLLAALSSRHLSSAHADLGR-
640|gene|hhi        DVLGYGGGGDPAGSNADALAEVIAAGALAGELSLLAALSSRHLSSAHADLGR-
                    .::*  *** * *:*.:.*** **. :*.**:.**.**.*..*::** :***