HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0579COG0087KOG3141 KOG0746arCOG04070Ribosomal protein L350S ribosomal protein L13P

HOG Organism Gene ID Name Annotation
cHOG0579 nrc1 VNG1689 rpl3p 50S ribosomal protein L13P
cHOG0579 hmu HMUK1828 Hmuk_1828 ribosomal protein L3
cHOG0579 hma RRNAC1611 rpl3p 50S ribosomal protein L3P
cHOG0579 hwa HQ2842A rpl3p 50S ribosomal protein L3P
cHOG0579 hla HLAC2449 Hlac_2449 ribosomal protein L3
cHOG0579 hbo HBOR10230 Hbor_10230 LSU ribosomal protein L3P
cHOG0579 hut HUTA2292 Huta_2292 ribosomal protein L3
cHOG0579 hvo HVO_2564 HVO_2564 rplC ribosomal protein L3
cHOG0579 nph NP4854A rpl3p 50S ribosomal protein L3P
cHOG0579 hhi 2154 rplC 50S ribosomal protein L3P
MUSCLE (3.6) multiple sequence alignment


2842|gene|hwa       MPQPSRPRKGSMGFSPRKRAESEVPRIRSWASNDGAPGVQGFAGYKAGMTQVLMVNDEAN
2449|gene|hla       MPQPSRPRKGSLGYGPRTRADREVPRIRSWPDDDGAPALQGFAGYKAGMTHVVMVNDEAN
10230|gene|hbo      MPQPSRPRKGSMAYSPRQRAAKEVPRIRSWPDDDGSPGLQGFAGYKAGMTQVMMVNDEAN
1689|gene|nrc1      MPQPNRPRKGSMGFSPRKRAESEVPRFNSWPADDGEVGLQGFAGYKAGMTHVVLVDDKAN
4854|gene|nph       MPQPSRPRKGSMGFSPRSRAASEVPRFNSWPDDEGQPGLQGFAGYKAGMSHVVAINDEPN
11611|gene|hma      MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPN
2154|gene|hhi       MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPN
2292|gene|hut       MPQPSRPRKGSLGYGPRTRATSETPRFNSWPDDEGQPGVQGFAGYKAGMSHVVVINDEPN
                    ****.******:.:.** *:  *.**:.**. ::*  .:**********::*: ::*:.*

2842|gene|hwa       SPREGMEEAVPVTVVETPPMRAVALRAYEDTPYGSKPLTEVWGREFDTSLERTLDLPNED
2449|gene|hla       SPREGMETSVPVTVVETPPMYAVALRAYEQTPYGKKPVEEVWATEFHEELDRALDLPAED
10230|gene|hbo      SPREGMEEAVPVTVVETPPMRAVAVRAYEDTPYGAKPLTEVWASEFVENLDRTLDLPSED
1689|gene|nrc1      APTEGMETTVPVTVVETPPMRAAAVRLYEDTPYGKKPLTEVWADDTHESLDRTLSVPDE-
4854|gene|nph       SPREGQEETVPVTVVETPPMRAVAVRAYEDTPYGKRPLTEVWTDEVHEDLERSLSVPEEQ
11611|gene|hma      SPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDH
2154|gene|hhi       SPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDH
2292|gene|hut       SPREGMEETVPVTVVETPPMRAVALRAYEDTPYGLRPLTEVWTDEFHEDLDRAIDLPAEQ
                    :* ** * :*****:***** *.*:* **:**** .*: ***  :   .*:*::.:* : 

2842|gene|hwa       TFEDDAAALRDDAETGDIDDVRLITHTLPAGMRNIPKKTPDVMETRVGGGTLTDRVEFGL
2449|gene|hla       TFEEDADELRALLDEGAVDDVRVITHTVPSELANVPKKKPDVMETRVGGGSLEERVDFGL
10230|gene|hbo      TFEEDADDLRAAVEAGEVDDIRVITHTVPASMKNIPKKKPDVMETRVGGGSLQERSDFAL
1689|gene|nrc1      --GGDTDELIEALDTEEIADIRVITHTVPGDTAGVPKKNPDVMETRVGGGTLADRLEFAA
4854|gene|nph       S-GDIEGDIRTALDEGALADVRVITHTVPGALSSVPKKEPDVMETRVGGGSLSDRVDFAL
11611|gene|hma      DPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHAL
2154|gene|hhi       DPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHAL
2292|gene|hut       DRDGAEAQIRDALDAGRLGDVRLITHTVPGDLPSVPKNKPDVMETRVGGGSLADRLEHGL
                            :    :   : *:*:****:*    .:**: ***********:: :* :.. 

2842|gene|hwa       DLISDGGEHEISDIFRAGEYLDAAGVTKGKGTQGPVKRFGVQKRKGKHARQGYRRRIGNL
2449|gene|hla       DLVAEGGAHEFGDVFRAGQYTDVSGITKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
10230|gene|hbo      DLVEEGGEHSMSDVFRAGEYLDAAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
1689|gene|nrc1      DLIEDGGVHAFGDVFRAGEFTDAAGITKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
4854|gene|nph       DLVDDGGEHTVTDVFRAGEYTDVAGITKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
11611|gene|hma      DIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
2154|gene|hhi       DIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
2292|gene|hut       ELVADGGEYAMTDVFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
                    ::: :** : . *:****:: *.:*:************:*************:*******

2842|gene|hwa       GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIEIGNGDEPTVDGGFVGYGEVDGPYALIKG
2449|gene|hla       GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDFGEGDDASVDGGFVNYGEVDGEYALIKG
10230|gene|hbo      GPWNPSRVRSTVPQLGQTGYHQRTELNKRLIDLGDGDDATVDGGFVGYGEVDGPYALVKG
1689|gene|nrc1      GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDINDGDEPTPDGGFPNYGEVDGPYTLVKG
4854|gene|nph       GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDLGD-DDVSPDGGFVNYGEVDGPYALVKG
11611|gene|hma      GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKG
2154|gene|hhi       GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKG
2292|gene|hut       GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDFGDEDDVTPDGGFVNYGEVEGNYALIKG
                    ************** ****************::.: *: : **** .****:* *:*:**

2842|gene|hwa       SLPGPDQRLLRFRTAVRPSDQPRLDPEVRYVSTASNQG
2449|gene|hla       SLPGPDKRLIRFRPAIRPNDQPRLDPEVRYVSTASNQG
10230|gene|hbo      SLPGPDKRLLRFRPAIRPNDQPRLDPEVRFVSTASNQG
1689|gene|nrc1      SVPGPEQRLVRFRPAVRPNESPRLDPEVRYVSTASNQG
4854|gene|nph       SVPGPDKRLVRFRPAVRPGDQPRLDPEVRYVSTASNQG
11611|gene|hma      SVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG
2154|gene|hhi       SVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG
2292|gene|hut       SIPGPDSRLVRLRPAVRPNDQPRLDPEVRYVSTESNQG
                    *:***:.**:*:*.*:**.:.********:**. ****