HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0578COG1141arCOG00349Ferredoxinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0578 nrc1 VNG2370 vng2370 no entry
cHOG0578 hmu HMUK0688 Hmuk_0688 conserved hypothetical protein
cHOG0578 hma RRNAC2875 hypothetical protein
cHOG0578 hwa HQ1016A ferC ferredoxin III
cHOG0578 hla HLAC0016 Hlac_16 hypothetical protein
cHOG0578 hbo HBOR02240 Hbor_02240 ferredoxin
cHOG0578 hut HUTA2128 Huta_2128 conserved hypothetical protein
cHOG0578 hvo HVO_0015 HVO_0015 Ferrodoxin
cHOG0578 nph NP0494A ferC ferredoxin III
cHOG0578 hhi 144 HAH_0144 ferredoxin
MUSCLE (3.6) multiple sequence alignment


2128|chp|hut       MRIEFDRETCIGMFQCVVEY-DAFERDEDAGKAVLVDGEETDDGMVTLDVAADEELDAKF
2370|chp|nrc1      MRVEFDRDTCIGMFQCVAEWGDGFDEDTDAGKAVLVDGDAIGDDVFAVDVPDGDELDAKF
12875|hp|hma       MRVEYDYDTCIGMFQCVAEW-DAFERDEDAGKAVLADSEEQDEDVFVREVPDDAELDAKF
144|gene|hhi       MRVEYDYDTCIGMFQCVAEW-DAFERDEDAGKAVLADSEEREEDVFVREVPDDAELDAKF
16|hp|hla          MRVKFDRDTCVGMYQCVAEW-DAFEKNLNDGKADLRGSEEEDEDVFVVEVPDGEEFDAKF
1016|gene|hwa      MRIRYNRETCIGMFQCVNEW-DSFEENIDAGKAELAKADEVEDGIFEREVPEDVEFEAKF
2240|gene|hbo      MKIRYDRDTCIGMFQCVDEW-DTFEKNLDAGKADLAGAEEVEEDIFELEVPEDEEFEAEF
494|gene|nph       MKVRFDRETCIGMFQCVAEW-DAFEEDEDEGKADLDGAEEVAPGIFEREVPEDAEFDAKF
                   *.: :: :**:**:*** *: * *: : : *** *  .:    .:.  :*. . *::*:*

2128|chp|hut       AARTCPVDAITVYDDEGEQLVP
2370|chp|nrc1      AARTCPVDAITVYDDDGEQVVP
12875|hp|hma       AARTCPVDAITIYDDDGEQLIP
144|gene|hhi       AARSCPVDAITIYDDDGEQLIP
16|hp|hla          AARVCPVDAIEVYDDDGEQVV-
1016|gene|hwa      AARVCPVDAIEVYDDDGEQIV-
2240|gene|hbo      AARVCPVDAIELYDDDGEQVV-
494|gene|nph       AARSCPVDAIEIYDEDGEQLV-
                   *** ****** :**::***::