HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0577COG0633KOG3309arCOG02842Ferredoxinferredoxin

HOG Organism Gene ID Name Annotation
cHOG0577 nrc1 VNG0438 ferA3 ferredoxin
cHOG0577 hmu HMUK3126 Hmuk_3126 ferredoxin
cHOG0577 hma RRNAC0656 ferA3 ferredoxin
cHOG0577 hwa HQ2414A fer ferredoxin
cHOG0577 hla HLAC1430 Hlac_1430 ferredoxin
cHOG0577 hbo HBOR17470 Hbor_17470 ferredoxin
cHOG0577 hut HUTA0882 Huta_0882 ferredoxin
cHOG0577 hvo HVO_1482 HVO_1482 ferredoxin
cHOG0577 nph NP4568A ferA_2 ferredoxin I 2
cHOG0577 hhi 1310 fdx2 ferredoxin
MUSCLE (3.6) multiple sequence alignment


882|gene|hut        MAVYTVEFVGTGETIEVEDTDTILSRCLDEGIAQEYSCRVGMCLACSAKIIDGEVTQPAA
438|gene|nrc1       MTEYTVEFAGAGETIEVSDTETILKACLREGIAQEYSCRVGMCLACSAKIESGDVTQPAA
1430|gene|hla       MTEYTVEFVGTGETIEVADTETILQPCIEEGIAQEYSCRVGMCLACSAEIVEGEVTQPAA
2414|gene|hwa       MTEYTVEFLGTGETIEVSNKQTILKACIEAGIAQEYSCRVGMCLACSAEIVEGDVVQPAA
17470|gene|hbo      MTEYTVEFVGTGESIQVSDKQTILKACIEEGIAQEYSCRVGMCLACSAEILEGDVVQPAA
4568|gene|nph       MTDYTVEFVGTGETITVSDKDTILSRCIEEGIAQEFSCRVGMCLACSAEIIEGEVTQPAA
10656|gene|hma      MTEHTVTFVGTGEEITVSEKETILSRCIEEGIAQEYSCRVGMCLACSAEIVEGSVTQPAA
1310|gene|hhi       MTEYTVTFVGTGEEITVSEKETILSRCIEEGIAQEYSCRVGMCLACSAKIVEGSVTQPAA
                    *: :** * *:** * * :.:***. *:  *****:************:* .*.*.****

882|gene|hut        RGLTDKEKENYALTCMARPQSDLKLDRGKYPPSIEAEAAVEAGAGDEAAADD-
438|gene|nrc1       RGLTDAEADEYALTCMARPQTDLVLDRGKYPPSIEEEAAVA----DQAAADDD
1430|gene|hla       RGLTDEEAEEYALTCMARPQSDLKLDRGKYPPSIEDDAATDASDVDGAAADDD
2414|gene|hwa       RGLTETERDNYALTCMARPQSDLKIRRGVYPPSIEQDATQS-----DMAADD-
17470|gene|hbo      RGLTEEEREEYALTCMARPQSDLKLKRGVYPPSIEEDAASA-----AAAADDD
4568|gene|nph       RGLTDAEREDYALTCMARPQSDLKLDRGKYPPSIEDEVDVDADGTDAAAADD-
10656|gene|hma      RGLTDRERENYALTCMARPQSDLKLDRGKYPPSIEGDVSPE--DGDPTPADD-
1310|gene|hhi       RGLTDREREDYALTCMARPQSDLKLDRGKYPPSIEADVDLE--DGDPTPADD-
                    ****: * ::**********:** : ** ****** :.          .***