HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0575arCOG02286hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0575 nrc1 VNG0498 vng498 no entry
nucHOG0575 hmu HMUK2831 Hmuk_2831 conserved hypothetical protein
nucHOG0575 hma RRNAC0627 hypothetical protein
nucHOG0575 hwa HQ2636A hypothetical protein
nucHOG0575 hla HLAC1484 Hlac_1484 hypothetical protein
nucHOG0575 hbo HBOR16200 Hbor_16200 hypothetical protein
nucHOG0575 hut HUTA0340 Huta_0340 conserved hypothetical protein
nucHOG0575 hvo HVO_1595 HVO_1595 conserved hypothetical protein
nucHOG0575 nph NP4070A hypothetical protein
nucHOG0575 hhi 1285 HAH_1285 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2636|hp|hwa       ---------MNDRTAS-------NDGQQFDRLPATATDRVVAGRPTREEIIQWWNSRFGI
16200|hp|hbo      MSDETTGNGTEDQTPE-------NDGQQFDRLPATAEDRVVAGRPTREEVVEWWEQRYEV
4070|hp|nph       ---------MSAE----------NDGQRFDRLPETADERTVEGRATRAEVIDWWTERFGL
498|chp|nrc1      ---------MTD-----------NDSQTFGRLPATDAERSVAGRPTRAAVVDWWTDRFGV
1484|hp|hla       ---------MTDAAPT-------NDGQQFDRLPETPDDREVDGRASRREVLDWWDERFGI
340|chp|hut       ---------MTDGSASSDAELGENDGDRFDRLPATEDEREVQGRPTRQDVLDYWDDRFGV
10627|hp|hma      ---------MSDQSTE------------FTRLPETNEERDDPERATREEVLDFWADRFGV
1285|hp|hhi       ---------MSDQSTE------------FTRLPETDEEREDPERATREEVLDFWTERFGV
                                              * *** *  :*    *.:*  ::::* .*: :

2636|hp|hwa       SPTIWDYHTFWEKGNGKIWAVAAEYVSPLPIEGVGLRILRTRQEHWKPSTNAVQRFGTHA
16200|hp|hbo      PPETWDGHTFWEKGNGKIWAFAADVPTPSPVEGLGLRILRARQEHWKPSTNAVQRFCGEA
4070|hp|nph       AADHFSDHTFWEKGAGKIWAFADDIDSPARVEGLGMTFLRTRQEHWKPTTDAVQRFGADA
498|chp|nrc1      PRTIFESYTLWEKGAGKVWALPFDPGAPVPVEALGLTVLRTRQEHWKPTTIAAQRFGREA
1484|hp|hla       EPTVFEEYSFWEKGAGKVWIFNGEATDPSEVEAIGMTFLRTRQDHWKPTGRAVSRFGAHA
340|chp|hut       PPETFEEHTFWERGSGKIWVFYGDLPSPVHIEALGMTFLRTRQEHWKPTLEAVQRFGHHA
10627|hp|hma      PSETFEGYTFWERGAGKLWLYQGSPPSPVDIEGLGMTFLRTRQEHWKPTLEAVQRFGEHA
1285|hp|hhi       PPETFEGYTFWERGAGKLWLYQGSPPSPVDIEGLGMTFLRTRQEHWKPTLEAVQRFGEHA
                      :. :::**.* **:*    .   *  :*.:*: .**:**:****:  *..**   *

2636|hp|hwa       SKNVLTLED-EAALRFADGTDQSLPRWNGDWGYLIVAHKIAGKSEPIGVGLYLHDELRST
16200|hp|hbo      TKNVVVLEG-DEADRFVRGEDQELDRWDGDWGYLVAAHEFEGEREPIGVGLYLHGELRST
4070|hp|nph       TRNIVVLDA-ADAQAFLRGETTTP-GWDGDWGYLIAAHEIAGAVEPIGVGLYVHDEFRSQ
498|chp|nrc1      TRNVLRLDERDQAAAFLAGEEQEI-AWDGDWGYVIAAHELTGRLEPIGVGLYTYGTLQSM
1484|hp|hla       TKNVIELDP-EQAVTFAAGEDQDLPEWDGDWGYLIATHEVAGEQAPIGVGLYLYDELRSV
340|chp|hut       ETCVIHLSR-EQARTFLAGDDQAI-EWDGDWGYLIVAHNLAGEVEPLGVGLYIHGELRSQ
10627|hp|hma      SQNVIHLDE-DAARAFVAGEDHEL-DWDGDWGYLVVTHDLAGAAEPVGVGLYVYGELRSQ
1285|hp|hhi       SQNVIHLDE-DTARAFVAGEDQEL-DWDGDWGYLVVTHDLAGEAEPVGVGLYVYGELRSQ
                     :: *.    *  *  *       *:*****::.:*.. *   *:***** :. :.* 

2636|hp|hwa       VPKGRREDLS---
16200|hp|hbo      VPKGRQEDLS---
4070|hp|nph       MPKGRQREL----
498|chp|nrc1      VPKGRRREF----
1484|hp|hla       VPKGSRADLPVVE
340|chp|hut       VPKGRRREL----
10627|hp|hma      VPKGRRRDV----
1285|hp|hhi       VPKGRRREV----
                  :*** . :.