HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0573COG0613arCOG00306Predicted metal-dependent phosphoesterases (PHP family)Phosphoesterase domains associated with DNA polymerases of diverse origins

HOG Organism Gene ID Name Annotation
cHOG0573 nrc1 VNG0370 pad1 Phosphoesterase domains associated with DNA polymerases of diverse origins
cHOG0573 hmu HMUK2957 Hmuk_2957 conserved hypothetical protein
cHOG0573 hma RRNAC0696 hypothetical protein
cHOG0573 hwa HQ1240A hypothetical protein
cHOG0573 hla HLAC0932 Hlac_932 hypothetical protein
cHOG0573 hbo HBOR24960 Hbor_24960 predicted metal-dependent phosphoesterase, PHP family
cHOG0573 hut HUTA2469 Huta_2469 conserved hypothetical protein
cHOG0573 hvo HVO_0721 HVO_0721 conserved hypothetical protein
cHOG0573 nph NP0818A hypothetical protein
cHOG0573 hhi 1346 HAH_1346 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1240|hp|hwa       -------------------------------MVTANLTPYRTDDVTETTASTRVDLHVKV
10696|hp|hma      MSHSQRGICSVAGDPGLKTLAATCQKSVSQIAKTETPNGSTELALTVQPEGYAVDLHVKV
1346|hp|hhi       ---------------------------------------------------------MKV
932|hp|hla        ---------------------------------------------------------MKV
2469|chp|hut      --------------------------------------------------MTAVDPHVKV
370|hp|nrc1       ------------------------------------------------------------
24960|hp|hbo      -----------------------------MTNHAAISSTDVTATSASLSPSTRVDMHVKI
818|hp|nph        ------------------------------------------------MDRFRLDAHVKV
                                                                              

1240|hp|hwa       LSDEVVTCAKAREIDVIVYAPHFTRFDNIRSRAAQFSDDDLLVIPAREIFTGSWQTRRHI
10696|hp|hma      LDDGVVERAKARGLDALVYAPHFTRLSEIRRQAEAFSDEELTVFPAREIFTGTWQQRRHV
1346|hp|hhi       LDDGVVERAKARGLDALVYAPHFTRLPEIRRQAEAFSDEELTVFPAREIFTGTWQQRRHV
932|hp|hla        LDDDVVALAKERGIDALVYAPHFTRLPTIRKRAARFSDDDLTVVPAREVFTGDWGNRRHI
2469|chp|hut      LDGTVVRRAKARGLDVLVYAPHFKRLDDIRERAEQYSDDELLVVPGREVFTGSWRNRRHV
370|hp|nrc1       ----VIRRAKAADIDVLVYAPHFTRLPTIRERAAAYSDDDILVVPAREVFTGSYRDRKHV
24960|hp|hbo      LDERVVSRAKARGIDVLVYAPHFERLPDIRAKAAEFSDDELLVVPAREVFTGTWRQRRHL
818|hp|nph        LDETVAERAKARGLDGLVYAPHFTRLPDIRERAAEFTDDDLLVVPGREVFTGDWRNRKHV
                      *   **   :* :****** *:  ** .*  ::*::: *.*.**:*** :  *.*:

1240|hp|hwa       LAIGLNEPIPDFISLTGALDALDRQGAATLIPHPEFMNVSFSESDIQANADAVDAIEVYN
10696|hp|hma      LAIGLEDPIPDFITFDGAMRELDRQDAAVLVPHPGFLNVSLGLDDIEAYDDIIDALEVYN
1346|hp|hhi       LGIGLEEPIPDFITFDGAMRELDRQDAAVLVPHPGFLNVSLGLDDIEAYDDSIDALEVYN
932|hp|hla        LVLGLDEPVPDYITFEAAMAEADRQDAVVLAPHPGFATISLTRPEIAAHSTRIDAVETYN
2469|chp|hut      LAVGLEAPIPDFITLEAAMNEFDRQGVAVLTPHPSFLNVSLGPALIEEYRGVIDAIETCN
370|hp|nrc1       LAIGLEECVPDYITLDGALTELARQDAAVLAPHPGFLTVSLTPADIEAYRDRIDAVETYN
24960|hp|hbo      LAIGLTDPIPDFITMEAAFATFARQEAAVLVPHPDFLNVSLGREAVRAHADEIHAIETYN
818|hp|nph        LAVGLEAPVPDFITLEAAMAEFDRQDAAVLAPHPEFATVSLEAHDIRAHRDRIHAVEVYN
                  * :**   :**:*:: .*:    ** ...* *** * .:*:    :      : *:*. *

1240|hp|hwa       FKSPGWANTRSISLITETNHQPFGSSYAHLPGSVGRVWTTFDCAIDSEADLVEALKSGVS
10696|hp|hma      PKQLSHHRDRAQSFTSETGHEPFVSSYAHVRGTVGEAYVTFTKAFESVAGLSAALKDDVE
1346|hp|hhi       PKQLSHHRDRAQSFTSETGHEPFVSSYAHVRGTVGEAYVTFTEAFEDVAALSAALKDDVE
932|hp|hla        TKLLPHQNARTRRIAEATDQPGFGSSYAHLPGTVGEAWTEFDGDYDGVDGVVDAFREARP
2469|chp|hut      PKFWPHHERRAESIATAADLPTFGSSYAHLPRTVGEVWTTFEREIDDAADLVETFRAGVP
370|hp|nrc1       PKHAPHNNRRARRLADTHGMPAFGSSYAHLAGTVGEVWTTIDTTITSGSELTAALRDGVS
24960|hp|hbo      GKLFAGQNRPGREFSAEFDIPGFGSSYAHLRGSIGEAWTEFDREIESAEDLVAALREGAP
818|hp|nph        PKHFATHNERARELAAEFELPAFGSSYAHLPGTVGEVWTGFDRRFETADELVAALREGVP
                   *           :        * *****:  ::* .:. :         :  ::.    

1240|hp|hwa       RRVYHERGLRYTAHELAEFVHLVYENSWKKLDRLFLSGMEPTHPQHIAYDGKYDDVAEY-
10696|hp|hma      RSLFHRDGLSHDLRRAVEWAHLGLENTWGKFDRLMLQGTEPTHPDHVAYDGRFNDVKVY-
1346|hp|hhi       RSLFHRDGISHDIRRAVEWAHLGLENTWGKFDRLMLQGTEPTHPDHVAYSGRFDDVKVY-
932|hp|hla        RTVVHRGGIGHQLRGLVEFAHLAYENTWEKLDRQFLSGDEPTLPSNVAYEGRFNDVSVYS
2469|chp|hut      GDPAHRTGLTHYGQRAIEFAHLGWENSWKKIDRIVLSGREPTHPEQPAYEGRFDDVSVY-
370|hp|nrc1       RTVDHDTGLSHYRQRIAEKLHLGYENTWEKLDRVVLSGMERTHPRQVAYDGRFDDIAVY-
24960|hp|hbo      RRVMHRSGIGHRLRSAIEFAHLGFENSWGKLDRLFLSGMEPTHPGHIAYDGDFDDVREY-
818|hp|nph        RGVYHRDGPRHRLRCMAEFGHLFYENSWGKIDRLFLSGTEPTHPDHIAYDGRFDDVSVY-
                      *  *  :  .   *  **  **:* *:** .*.* * * * : **.* ::*:  * 

1240|hp|hwa       ---------
10696|hp|hma      ---------
1346|hp|hhi       ---------
932|hp|hla        GTLSDYRPK
2469|chp|hut      ---------
370|hp|nrc1       ---------
24960|hp|hbo      ---------
818|hp|nph        ---------