HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0572COG1727KOG1714arCOG00780Ribosomal protein L18E50S ribosomal protein L18E

HOG Organism Gene ID Name Annotation
cHOG0572 nrc1 VNG1137 rpl18e 50S ribosomal protein L18E
cHOG0572 hmu HMUK2593 Hmuk_2593 ribosomal protein L15
cHOG0572 hma RRNAC0064 rpl18E 50S ribosomal protein L18e
cHOG0572 hwa HQ2940A rpl18R 50S ribosomal protein L18e
cHOG0572 hla HLAC1820 Hlac_1820 ribosomal protein L15
cHOG0572 hbo HBOR12520 Hbor_12520 LSU ribosomal protein L18AE
cHOG0572 hut HUTA2520 Huta_2520 ribosomal protein L15
cHOG0572 hvo HVO_2779 HVO_2779 rpl18e Chain O
cHOG0572 nph NP2836A rpl18R 50S ribosomal protein L18e
cHOG0572 hhi 823 rpl18E 50S ribosomal protein L18e
MUSCLE (3.6) multiple sequence alignment


1820|gene|hla       MSSKTNPKLQNLIADLKSVSRDSGANVWQDIAARLEKPRRTHAEVNLGRIERYAQEDETV
2836|gene|nph       MSSKTNPRLSSLIADLKSTARNGGGEVWSDVAERLEKPRSTHAEVNLGRIERYAREDETV
10064|gene|hma      -MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETV
823|gene|hhi        -MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETV
2520|gene|hut       -MSKTNPRLRSLIADLKSVARDGGGDVWSDVAERLEKPRRTHAEVNLGRIERYAQEDETV
2940|gene|hwa       -MSKTNPRLDSLIAELKAKSRGSDANVWQDIADRLEKPRRTHAEVNLGRIERYAREDETV
1137|gene|nrc1      -MSKTSPRLSSLIAELKSVARDSGADVWHDVADRLEKPRSTHAEVNLSRIERYASEDETV
12520|gene|hbo      -MSKTNPRLNSLIAELKAVSRESGANVWQDVADRLEKPRRTHAEVNLGRIERYAKEDETV
                      ***.*.* .***:**: :* ... ** *:* ****** *******.****** *****

1820|gene|hla       VVPGKVLGSGVLEKNVTVAAVDFSGTARTKIDQA-GEAVSLEQFVEQNPEESNVRVIR
2836|gene|nph       IVPGKVLGSGALRKEVTVAAVDFSSTAQTKIDQV-GDAIELEQALEDNPDGSNVRVIR
10064|gene|hma      VVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQV-GEAVSLEQAIENNPEGSHVRVIR
823|gene|hhi        VVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQV-GEAVSLEQAIENNPEGSHVRVIR
2520|gene|hut       VVPGKVLGSGVLQKDVTVAAVDFSSTAERKIDQV-GETLRVEQALEDNPDGSNVRVIR
2940|gene|hwa       VVPGKVLGSGVLQKNITVAAVDFSSTAQTKIEQV-GDAEYLREYVKENPEGSNVRVIR
1137|gene|nrc1      IVPGKVLGSGALRKSVTVAAVDFSSSAATKIEHADGEAVHLEQAVEQNPDGTDVRVIR
12520|gene|hbo      IVPGKVLGSGVLEKNVTVAAVDFSSSARKKIEQV-GDTVTLEQIAEQNPDGSDVRVIR
                    :*********.* *.:********.:*  **::. *::  : :  ::**: : *****